infA1

Translation initiation factor IF-1 1

89 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.15 kDa

MSNKEQLIEMQGKVDEVLPDSRFRVVLENGHTLIAYSGGKMRKHRIRVLAGDTVSLEMSPYDLTKGRITFRHLEPRAGGAPRRPSPHRR

infA1

Translation initiation factor IF-1 1

88 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.078 kDa

MAKEELIELDGIVDEVLPDSRYRVTLDNGVVVGAYASGQMRRHRIRILAGDRVTLELSVYDLTKGRINFRHKDERRSDAAPRASARRR

infA1

Translation initiation factor IF-1 1

88 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.078 kDa

MAKEELIELDGIVDEVLPDSRYRVTLDNGVVVGAYASGQMRRHRIRILAGDRVTLELSVYDLTKGRINFRHKDERRSDAAPRASARRR

infA1

Translation initiation factor IF-1 1

88 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.078 kDa

MAKEELIELDGIVDEVLPDSRYRVTLDNGVVVGAYASGQMRRHRIRILAGDRVTLELSVYDLTKGRINFRHKDERRSDAAPRASARRR

infA1

Translation initiation factor IF-1 1

88 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.078 kDa

MAKEELIELDGIVDEVLPDSRYRVTLDNGVVVGAYASGQMRRHRIRILAGDRVTLELSVYDLTKGRINFRHKDERRSDAAPRASARRR

infA1

Translation initiation factor IF-1 1

88 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.078 kDa

MAKEELIELDGIVDEVLPDSRYRVTLDNGVVVGAYASGQMRRHRIRILAGDRVTLELSVYDLTKGRINFRHKDERRSDAAPRASARRR

infA1

Translation initiation factor IF-1 1

88 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.181 kDa

MSKEDMIELEGVVIEMLPESRFRVRLDNNMEILAYGSGKMKMHRIRVLLGDRVTVEMSPYDLTKGRINFRHPTANPGAGPRPSHHHRR

infA1

Translation initiation factor IF-1 1

87 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.067 kDa

MAKEELIELNGIVDEVLPDSRYRVKLDNGIEVGAYASGRMRKHRIRILAGDRVTLEMSPYDLTKGRINFRHKDERSGPPSRPPQHRR

infA1

Translation initiation factor IF-1 1

87 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.857 kDa

MAKEELLELDGIVDEVLPDSKYRVTLENGVVVGAYASGRMRKNHIRILAGDRVTLELSVYDLTKGRINFRHKDANSPRPPRTGQPRR

infA1

Translation initiation factor IF-1 1

87 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.643 kDa

MAADDHIEMEGVVEEALPGTLFRVVLENGHEVLAHLCGKMRKFRIRVLPGDKVTVHISPYDLTKGRIARRTTTPSGGPRPARSGNRR

infA1

Translation initiation factor IF-1 1

85 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.696 kDa

MSKEDLIEMQGKVEEVLPDSRFRVTLDNGHQLIAYAGGKMRKHRIRVLAGDRVSLELSPYDLNKGRLTFRHIEGRGPRAPQRGAR

infA1

Translation initiation factor IF-1 1

85 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.727 kDa

MAKEELIEMSGMVVEVLPDSRFRVTLDNGHNLVAYSAGKMRKHHIRILCGDKVSLELSPYDLSKGRITFRHLEGRGPLGPQRRRR

infA1

Translation initiation factor IF-1 1

85 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.667 kDa

MAKEELLEMSGTVLEVLPDARYRVTLDNGHSLVAYGAGKMRKHHIRIIAGDKVLLELSPYDLSKGRITFRHIEGRAPMTSRHQKR

infA1

Translation initiation factor IF-1 1

81 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.198 kDa

MAKEELLEMRGTVVELLPNAMFRVRLENDHEILGHTAGKMRKNRIRVLVGDEVLVELTPYDLTKGRITYRFMPGRGGPGGF

infA1

Translation initiation factor IF-1 1

75 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.736 kDa

MARSDMIEVDGVIVEPRSNGFFTVRLDLENQPEVIAHLGGKLRRHYIRVVPGDRVTVELSPYDLTRGRIVYRYRH

infA1

Translation initiation factor IF-1 1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.394 kDa

MAKEELIEFGGVVSEALPDNRYRVTLENGVEIWAYASGKMQKHRIRILAGDRVTLEMSPYDLTKGRINFRHKS

infA1

Translation initiation factor IF-1 1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.394 kDa

MAKEELIEFGGVVSEALPDNRYRVTLENGVEIWAYASGKMQKHRIRILAGDRVTLEMSPYDLTKGRINFRHKS

infA1

Translation initiation factor IF-1 1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.406 kDa

MAKEELIEFGGVVSEALPDNRYRVLLENGVEIWAYASGKMQKHRIRILAGDRVTLEMSPYDLTKGRINFRHKS

infA1

Translation initiation factor IF-1 1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.411 kDa

MAKKQGAIEIEGTVVESLPNAMFKVELQNGHQVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRYK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.264 kDa

MSKDDVIQMQGEVLENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLTRARIVFRSK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.264 kDa

MSKDDVIQMQGEVLENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLTRARIVFRSK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.264 kDa

MSKDDVIQMQGEVLENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLTRARIVFRSK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.218 kDa

MAKDDVIQMQGEVIENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.218 kDa

MAKDDVIQMQGEVIENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.218 kDa

MAKDDVIQMQGEVIENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.218 kDa

MAKDDVIQMQGEVIENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.331 kDa

MAKEDYIEMLGEVVENLPNATFKVRLENGHIVHGFISGKMRMHYIRILPGDKVTVQLTPYDLTKARIVFRTK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.143 kDa

MAKEEAITVTGVVQEALPNAMFRVELENGHEVLAHISGKMRKFHIRVLPGDKVSVELSPYDLTRGRITFRPR

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.329 kDa

MAKEDAIEVDGVVQEALPNAMFRVELQNGHEVLAHISGKMRKFYIRILPGDRVKVELSPYDLKRGRITYRMK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.348 kDa

MAKEDRIEMQGEVLENLPNATFRVKLENGHVVLGYISGKMRMHYIRILPGDKVTVEMTPYDLSRARIIFRAK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.218 kDa

MAKDDVIQMQGEVIENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.287 kDa

MSKDDVIQMAGEVVENLPNAMFRVKLENGHVFLGHISGKMRMHYIRILPGDKVTVEMTPYDLTRARIIFRAK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.22 kDa

MSKDDVIQMQGEVVENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.233 kDa

MAKDDVIQMQGEVQENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK

infA1

Translation initiation factor IF-1 1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.234 kDa

MSKEDVIQMQGEVIENLPNATFRVKLENGHVLLGHISGKMRMHYIRILPGDKVTVELTPYDLTKGRIVFRAK

infA1

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.194 kDa

MAKEEAITVDGTVLEPLPNAMFRVELENGHKVLAHISGKMRMHYIRILPGDKVTVELSPYDLSKGRITYRKK