infA

Translation initiation factor IF-1, chloroplastic

156 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

17.404 kDa

MASLSWWNPAPATAAMAACSPTPTSCKTSNSLALPRSVFVSKQEELMKQAKSLLVKTQQQSKKKKNNSTNSRRTTSIQCLSQEQKWTHEGSITESLPNGMFRVKLDNADVVLGYISGKIRKNFIRLLPGDRVKIEVSRYDSSKGRIIYRLRGGREG

infA

Translation initiation factor IF-1, chloroplastic

156 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

17.379 kDa

MAASLTLMTSPPCSRSSKSPSPSPSPSLSCNQQQQYKPLLHHQWPPQISLKKEKSNESIVAKSPVIAAATKGGSPSVQEQKWIHEGVITESLPNGMFWVKLDNCEDLVLGYISGRIRRSFIRVLPGDRVKIEVSRYDSTRGRITYRLRNNKDATTT

infA

Translation initiation factor IF-1, chloroplastic

138 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

15.43 kDa

MFTSLHTPILHPRYCHHPTPSCTQFSPLALPPFHRTLSFLAPPPLLPAAPALSAASAAKPDKSGEQKWVHEGLIMESLPNGMFRVRLDNEDLILGYISGKIRKNYVRILPGDRVKVEVTRYDSSKGRIVYRLRSSTPS

infA

Translation initiation factor IF-1, chloroplastic

113 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

13.117 kDa

MTEKKNRREKKNPREAKVTFEGLVTEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRLPHKDSKRIEDSKDSEDLKDSEDLKDTKDSKD

infA

Translation initiation factor IF-1, chloroplastic

113 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

13.117 kDa

MTEKKNRREKKNPREAKVTFEGLVTEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRLPHKDSKRIEDSKDSEDLKDSEDLKDTKDSKD

infA

Translation initiation factor IF-1, chloroplastic

113 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

13.117 kDa

MTEKKNRREKKNPREAKVTFEGLVTEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRLPHKDSKRIEDSKDSEDLKDSEDLKDTKDSKD

infA

Translation initiation factor IF-1, chloroplastic

109 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

12.559 kDa

MRLAPIKLVVNYYVLFGKSLNQEKENLIEMKGVITQCLSNGMFRVKLENGFKVIAHISGKIRRNFIRILLGDSVIVELSPYDLTRGRIIYRLKPTNSSTETLRFNTNLK

infA

Translation initiation factor IF-1, chloroplastic

107 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

12.431 kDa

MTEKKNRREKKNPREAKVTFEGLVTEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRLPHKDSKRTEDSKDTEDLKDTKDSKD

infA

Translation initiation factor IF-1, chloroplastic

107 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

12.431 kDa

MTEKKNRREKKNPREAKVTFEGLVTEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRLPHKDSKRTEDSKDTEDLKDTKDSKD

infA

Translation initiation factor IF-1, chloroplastic

107 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

12.431 kDa

MTEKKNRREKKNPREAKVTFEGLVTEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRLPHKDSKRTEDSKDTEDLKDTKDSKD

infA

Translation initiation factor IF-1, chloroplastic

107 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

12.414 kDa

MTEKKNRREKKNPREAKVTFEGLVTEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRLPHKDSKRIEDSKDSEDLKDITDSKD

infA

Translation initiation factor IF-1, chloroplastic

107 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

12.376 kDa

MTEKKNSREKKNPREAKVTFEGLVTEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEISRYDSSKGRIIYRLPHKDSKRTEDSKDTEDLKDTKDSKD

infA

Translation initiation factor IF-1, chloroplastic

107 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

12.417 kDa

MTEKKNRREKKNPREAKITFEGLVMEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRLPHKDSKRTEDSKDTEDLKDTKDSKG

infA

Translation initiation factor IF-1, chloroplastic

107 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

12.417 kDa

MTEKKNRREKKNPREAKITFEGLVMEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRLPHKDSKRTEDSKDTEDLKDTKDSKG

infA

Translation initiation factor IF-1, chloroplastic

107 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

12.417 kDa

MTEKKNRREKKNPREAKITFEGLVMEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRLPHKDSKRTEDSKDTEDLKDTKDSKG

infA

Translation initiation factor IF-1, chloroplastic

107 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

12.417 kDa

MTEKKNRREKKNPREAKITFEGLVMEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRLPHKDSKRTEDSKDTEDLKDTKDSKG

infA

Translation initiation factor IF-1, chloroplastic

107 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

12.46 kDa

MTEKKNRREKKNPREAKVTFEGLVTEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRLPHKDSKRMEDSKDIEDLKDSEDSKD

infA

Translation initiation factor IF-1, chloroplastic

101 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

11.609 kDa

MNQLKKSFSPTEGKKDQNNLINDPQKNKQKKQKKLVDMEGLVTHNLSNGKFRLKLENGVEVIGHLSGKIRQNRIKIVVGDKVTVELSPYDLTKGRITYRHR

infA

Putative translation initiation factor IF-1, chloroplastic

96 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

11.407 kDa

LLNRLPNGLFRVCLDLIINYVSGKIRHSFIRILPGDRVKIEVSPYDSTKGRIIYRLHNKDLKDSFFNFTIPFVGIQFEMKNFKKLIFFQEIDSELR

infA

Translation initiation factor IF-1

96 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.838 kDa

MAKEELIQFEGLVTEILPDARYRVQLDAGHEIVAYTAGKMKKNRIKTLAGDRVTVEMSPYDLEKGRLIFRHKDERPATSGGPPRGGAQRGGQFRRR

infA

Translation initiation factor IF-1

95 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.741 kDa

MAKEELIEMDGVVTDVLPDSRFKVQLDNGHEVMAYSAGKMKKHRIRIMVGDRVDMEMTPYDLTKARITYRHKVGGPPGPVTGGGNRPPPRQPRRR

infA

Translation initiation factor IF-1

94 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.693 kDa

MAKEELIQFEGLVTEILPDARYRVQLDAGHEIVAYTAGKMKKNRIKTLAGDRVTIEMSPYDLEKGRLIFRHKDERPGGTGAPRSGPPRGQFRRR

infA

Translation initiation factor IF-1

94 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.677 kDa

MAKEELIQFEGLVTEILPDARYRVQLDAGHEIVAYTAGKMKKNRIKTLAGDRVTIEMSPYDLEKGRLIFRHKDERPGGTGAPRGAPPRGQFRRR

infA

Translation initiation factor IF-1

93 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.592 kDa

MAKEELIQFEGLVTEILPDARYRVQLDAGHEIVAYTAGKMKKNRIKTLAGDRVTIEMSPYDLEKGRLIFRHKDERPSGAPRGGPPRGGQFRRR

infA

Translation initiation factor IF-1

93 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.618 kDa

MAKEELIQFEGLVTEILPDARYRVQLDAGHEIVAYTAGKMKKNRIKTLAGDRVTIEMSPYDLEKGRLIFRHKDERPGGPPRSGPPRGGQFRRR

infA

Translation initiation factor IF-1

93 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.592 kDa

MAKEELIQFEGLVTEILPDARYRVQLDAGHEIVAYTAGKMKKNRIKTLAGDRVTIEMSPYDLEKGRLIFRHKDERPSGAPRGGPPRGGQFRRR

infA

Translation initiation factor IF-1

93 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.618 kDa

MAKEELIQFEGLVTEILPDARYRVQLDAGHEIVAYTAGKMKKNRIKTLAGDRVTIEMSPYDLEKGRLIFRHKDERPGGPPRSGPPRGGQFRRR

infA

Translation initiation factor IF-1

93 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.602 kDa

MAKEELIQFEGLVTEILPDARYRVQLDAGHEIVAYTAGKMKKNRIKTLAGDRVTIEMSPYDLEKGRLIFRHKDERPGGGPPRGAPPRGQFRRR

infA

Translation initiation factor IF-1

92 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.577 kDa

MAKEELIQFEGLVTEILPDARYRVQLDTGHEIVAYTAGKMKKNRIKTLAGDRVTVEMSPYDLEKGRLIFRHKDERPGGPPRSGPPRGQFRRR

infA

Translation initiation factor IF-1

91 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.564 kDa

MAKEELLEFEGTVTEVLPDGNFRVRLDNDHQILAYAAGKMKKNRIRTIEGDRVVVEMSPYDLDRGRINFRHKAEGNAPPPGARRQQNFRRR

infA

Translation initiation factor IF-1

90 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.453 kDa

MIYLKNKEDVIRMEGTIVEALPNAMFRVQLDNGFKVLAHVSGKMRKNFIRLVPGDRVVVELTIYDLTRGRIVYRKKLDSKGEEEILDDDE

infA

Translation initiation factor IF-1

90 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.559 kDa

MEKLTYYQEITFNGKKQKRKKEEVIKMTGKVTKMHSTKNYDVLLENDQEIKAYISGKMSLHNIKLIPGDMVDVEISPFNLTLGRIVFRHK

infA

Translation initiation factor IF-1, chloroplastic

89 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.158 kDa

MKEKEAKWVVEGLVTEGHPSGMFRVQLDNGARVLGYISGKIRRKAIRIMQGDRVQIELSHYDLTKGRIIYRLPPPPIPKPKDSEDDSED

infA

Translation initiation factor IF-1, chloroplastic

89 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

10.413 kDa

MKKQDLIDMEGIVTESLPNAMFRVCLDNGCQVLTHISGKIRRNYIRILPGDRVRVELSPYDLTKGRIIYRLRNKYPNGISQEVFRSMRD

infA

Translation initiation factor IF-1

87 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.871 kDa

MCQNGAQGSFRGAPPLSKEDVIEMEGTVLENLPNAMFKVELENKHSLLCHISGRMRKNYIRILPGDKVTVQLTPYDLTKGRISYRHK

infA

Translation initiation factor IF-1

86 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.851 kDa

MPKDDVIKMEGTITEARRNATFLVELDNGHKILAQISGRMRKNFIRLFPGDRVVVELSIYDLTKGRIVYRKKLDRKGSDEGTGERS

infA

Translation initiation factor IF-1

85 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.504 kDa

MAKEELLEMRGKVVELLPNAMFRVELENGHEVLGHTAGKMRKNRIRVLVGDEVLCELTPYDLTKARITYRFMPGRGGPGQGPGPQ

infA

Translation initiation factor IF-1

85 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.536 kDa

MAKEELIEMHGLVDEVLPDSRFRVTLDNGHKLVAYTSGKMRKNHIRILAGDQVSLELSPYDLSKGRITFRHIAGRGPGPAPRQSR

infA

Translation initiation factor IF-1, chloroplastic

84 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.699 kDa

MKKQNLVEMEGTITESLPNAMFRVCLDNGCYVLAHISGKIRRNYIRILIGDRVKVELSPYDLSKGRITYRLRIKSINDSNDLIK

infA

Translation initiation factor IF-1

83 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.234 kDa

MAKEELIEMQGSVTEVLPDSRFRVTLDNGHQLIAYTGGKMRKHHIRILAGDKVSLEMSPYDLSKGRITFRHLAGRGPGPSSSR

infA

Translation initiation factor IF-1

83 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.234 kDa

MAKEELIEMQGSVTEVLPDSRFRVTLDNGHQLIAYTGGKMRKHHIRILAGDKVSLEMSPYDLSKGRITFRHLAGRGPGPSSSR

infA

Translation initiation factor IF-1

83 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.326 kDa

MAKEESIEMQGTVVDSLPNTTFRVKLENGHVVTAHISGRMRKHYIRILTGDAVTVELTPYDLTRGRIVYREAGKKPPTSKAEE

infA

Translation initiation factor IF-1

83 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.326 kDa

MAKEESIEMQGTVVDSLPNTTFRVKLENGHVVTAHISGRMRKHYIRILTGDAVTVELTPYDLTRGRIVYREAGKKPPTSKAEE

infA

Translation initiation factor IF-1

83 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.326 kDa

MAKEESIEMQGTVVDSLPNTTFRVKLENGHVVTAHISGRMRKHYIRILTGDAVTVELTPYDLTRGRIVYREAGKKPPTSKAEE

infA

Translation initiation factor IF-1, chloroplastic

82 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.405 kDa

MNKQNLIDVEGSVTESLPNGMFRVRLDNGCQVPTHISGKIRRNHVRILPGDRVKVELSPYDLTKGRIIYRLRNKSSNDWITS

infA

Translation initiation factor IF-1, chloroplastic

82 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.405 kDa

MNKQNLIDVEGSVTESLPNGMFRVRLDNGCQVPTHISGKIRRNHVRILPGDRVKVELSPYDLTKGRIIYRLRNKSSNDWITS

infA

Translation initiation factor IF-1, chloroplastic

80 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.492 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNVDNEDLILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

80 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.436 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNVDNEDLILGYVSGRIRRSFIRILPGXRVKIEVSRXDSTRGRIIYRLRNKDSNB

infA

Translation initiation factor IF-1, chloroplastic

80 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.492 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNVDNEDLILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

80 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.436 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNVDNEDLILGYVSGRIRRSFIRILPGXRVKIEVSRXDSTRGRIIYRLRNKDSNB

infA

Translation initiation factor IF-1, chloroplastic

80 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.299 kDa

MKEHDLINMEGIVTESLPNAMFRVFLDNGCHVLTHISGKIRRNYIRILPGDRVKVELSIYDLTKGRILYRIRNEASKDTL

infA

Translation initiation factor IF-1, chloroplastic

80 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.263 kDa

MKKQNLIDMEGTVTESLPNATFRACLDNGCQVLTHISGRMRRSYIRILPGDRVRVELSPYDLTKGRIIYRLRSRHTNNSQ

infA

Translation initiation factor IF-1

80 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.196 kDa

MGKKKRKQEHEKERGILLEGEVVEALPNGMFRVKLETGQEVLAHIAGKLRVNFIRILPGDKVKVELSPYDLTRGRIVYRL

infA

Translation initiation factor IF-1

80 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.313 kDa

MPEQREKRKKEESDVVRAEGVVEEALPNTTFRVKLDSGHDILAYISGKMRIHYIRILPGDRVVLEISPYDTSRGRIVYRK

infA

Translation initiation factor IF-1

80 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.301 kDa

MPEQREKKKKDESDSVRAEGVVEEALPNTTFRVKLDTGHDILAYISGKMRIHYIRILPGDRVVLEISPYDTSRGRIVYRR

infA

Translation initiation factor IF-1, chloroplastic

79 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.995 kDa

MTRKNIDLIEMEGVVTQCLSNGMFRVKLENGFLVLAHVSGKIRRNSIRILLGDRVAVELSPYDLHRGRITFRLRPGSKT

infA

Translation initiation factor IF-1, chloroplastic

79 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.995 kDa

MTRKNIDLIEMEGVVTQCLSNGMFRVKLENGFLVLAHVSGKIRRNSIRILLGDRVAVELSPYDLHRGRITFRLRPGSKT

infA

Translation initiation factor IF-1, chloroplastic

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.922 kDa

MSKQNLIEIEGLVTESLPNAMFRVCLDNGCEVLTHISGKIRKNYIRILPGDRVKVELSPYDLTKGRITYRLRSKNTNT

infA

Translation initiation factor IF-1, chloroplastic

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.032 kDa

MKKQKLIDMEGVVTESLPNTMFRVCLDNGCQVLTHVSGRMRRNYIRILPGDRVKVESSPYDLTKGRITYRFHTKSSND

infA

Translation initiation factor IF-1

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.062 kDa

MSKNNLNETESKIEIEAKVVELLSNDKFKVELPNKKTIIAYVSGKIRINNIRILPGDKVRIELSPYDPTRARITYRFK

infA

Translation initiation factor IF-1, chloroplastic

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.922 kDa

MSKQNLIEIEGLVTESLPNAMFRVCLDNGCEVLTHISGKIRKNYIRILPGDRVKVELSPYDLTKGRITYRLRSKNTNT

infA

Translation initiation factor IF-1, chloroplastic

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.032 kDa

MKKQKLIDMEGVVTESLPNTMFRVCLDNGCQVLTHVSGRMRRNYIRILPGDRVKVESSPYDLTKGRITYRFHTKSSND

infA

Translation initiation factor IF-1

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.062 kDa

MSKNNLNETESKIEIEAKVVELLSNDKFKVELPNKKTIIAYVSGKIRINNIRILPGDKVRIELSPYDPTRARITYRFK

infA

Translation initiation factor IF-1, chloroplastic

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.924 kDa

MKKQNLIDMEGVVTESLPNAMFRVCLDNGCEVLTHISGKIRRNYIRILPGDRVKVELTPYDLTKGRITYRLRAKSSNS

infA

Translation initiation factor IF-1, chloroplastic

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.809 kDa

MKKQNLIHAEGLVTESLPNGMFRVLTDNGCQILTHISGRIRRNSVRILPGDRVKVELSAYDLTKGRIIYRLSNKSSND

infA

Translation initiation factor IF-1, chloroplastic

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.978 kDa

MEKQKLIDMEGVVIESLPNATFRVYLDNGCIVLTHISGKIRRNYIRILPGDRVKVELSPYDLTKGRITYRLRAKSSNN

infA

Translation initiation factor IF-1, chloroplastic

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.971 kDa

MASNRELIEMEGVVVESLPNAMFQVELENGFQVLAHISGKIRRNSIKILLGDRVTVELTPYDLTKGRIIYRLRKDRTQ

infA

Translation initiation factor IF-1

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.025 kDa

MQPKFNNQAKQDKLVLTGKILEIIHGDKFRVLLENNVEVDAHLAGKMRMRRLRILPGDLVEVEFSPYDLKLGRIIGRK

infA

Translation initiation factor IF-1, plastid

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.955 kDa

MKKQDLIDMEGVVTESLPNAMFRVCLDNGCQVLTHISGRIRRNYIRILPGDRVRVESSPYDLTKGRITYRLRAKSSTD

infA

Translation initiation factor IF-1, chloroplastic

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.95 kDa

MEKQNLIDMEGVVTESLPNAMFRVCLDNGCQVLTHISGKIRRNYIRILPGDRVKVELSPYDLTKGRITYRLRTKSSNP

infA

Translation initiation factor IF-1, chloroplastic

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.922 kDa

MKKQNLIEMEGIVTESLPNAMFRVSLDNGCQVLAHISGKIRRNYIRILPGDKVKVELSPYDLTKGRITYRLRMKTTNG

infA

Translation initiation factor IF-1

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.888 kDa

MAKEAEMEFEGTVVEVLPNAKFKVQLENDIVIDAHVSGKIRMHYIRILPGDKVTVVISPYDMTRGRITYRKIAKKAEV

infA

Translation initiation factor IF-1

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.082 kDa

MSKNNLNETESKIEIEAKVVELLSNDKFKVELPNKKTIIAYVSGKIRINNIRILPGDKVRIELSPYYPTQARITYRFK

infA

Translation initiation factor IF-1

78 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.933 kDa

MAKEEAIEVEGTIIEPLPNAMFRVELDNGHKVLAHISGKMRMHFIKILPGDRVTVELSPYDLTRGRVTFRTKNTKKKK

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.152 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNENMILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTKGRIIYRIRNKDSNN

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.897 kDa

MKKQNLIEMEGVVTESLPNAMFRVYLDNGCEVLAHISGKIRRNYIRILLADRVKVELSPYDLTKGRITYRLRTKSNG

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.09 kDa

MKEQKLIHEGLITESLPNGMFRVRLDNEDLILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.138 kDa

MKEQKWTHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.086 kDa

MKEQKWINEGLITESLPNGMFRVRLDNEDLSLGYVSGKIRRSFIRVLPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.181 kDa

MKEQKWIHEGLITESLPNGMFRIRLDNQDMILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.061 kDa

MKEQKLIHEGVIIESLPNGMFRVRLDNEDLILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTKGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.993 kDa

MKEQKLIHEGLITESLPNGMFRVRLDNEDLILGYVSGRIRRSFIRILPGDRVKIEVSSYDSTKGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, plastid

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.245 kDa

MKEQKWIHEGLITESLTNGMFWVRLDNKDLIIGYVSGNIRHSFIRILPGDKVKIEVSRYNSTRGRIIYRLRNKYYKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.15 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.154 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFMRILPGDRVKVEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.181 kDa

MKEQKWIHEGLITESLPNGMFRIRLDNEDMILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKNSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.168 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDMILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.09 kDa

MKEQKLIHEGLITESLPNGMFRVRLDNEDLILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.138 kDa

MKEQKWTHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.086 kDa

MKEQKWINEGLITESLPNGMFRVRLDNEDLSLGYVSGKIRRSFIRVLPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.181 kDa

MKEQKWIHEGLITESLPNGMFRIRLDNQDMILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.061 kDa

MKEQKLIHEGVIIESLPNGMFRVRLDNEDLILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTKGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.993 kDa

MKEQKLIHEGLITESLPNGMFRVRLDNEDLILGYVSGRIRRSFIRILPGDRVKIEVSSYDSTKGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, plastid

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.245 kDa

MKEQKWIHEGLITESLTNGMFWVRLDNKDLIIGYVSGNIRHSFIRILPGDKVKIEVSRYNSTRGRIIYRLRNKYYKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.15 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.154 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFMRILPGDRVKVEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.181 kDa

MKEQKWIHEGLITESLPNGMFRIRLDNEDMILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKNSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.168 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDMILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.181 kDa

MKEQKWIHEGLITESLPNGMFRIRLDNEDMILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKNSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.151 kDa

MKEQKLIHEGLITESLPNGMFRVRLDNEDLILGYISGRIRRSFIRILPGDRVKIEMSRYDSTRGRIIYRLRKKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.09 kDa

MKEQKLIHEGLITESLPNGMFRVRLDNEDLILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.109 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRSKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.168 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDMILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.117 kDa

MKEQKWIHEGLITESLPNGMFWVRLDNEDPILGYVSGRIRRSSIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.877 kDa

MRKQNLIEMEGIVTESLPNAMFRVCLDNGCQVLAHISGKIRKNYIRILLGDRVKVELSPYDLTKGRITYRLRTRSPS

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.168 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDMILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.122 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDKVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.085 kDa

MKRQKWIHEGLITESPSNGMFRVRLDNXDLIPSYVSGKIRRSLIRILPGDKVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.09 kDa

MKEQKLIHEGLITESLPNGMFRVRLDNEDLILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.15 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.164 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.959 kDa

MNKQGLFQMEGLVIESLPNAMFRVRLQNGFVILAHISGKIRRNYIRIIVGDRVLCELTPYDLTKGRIVYRQRSTPRP

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.106 kDa

MKEQKLIHEGLITESLPNGMFWVRLDNEDLVLGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.106 kDa

MKEQKLIHEGLITESLPNGMFWVRLDNEDLVLGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.074 kDa

MKEQKLIHEGLITESLPNGMFWVRLDNEDLVLGYISGRIRRSSIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSNE

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.074 kDa

MKEQKLIHEGLITESLPNGMFWVRLDNEDLVLGYISGRIRRSSIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSNE

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.976 kDa

MKEQKLIHEGLITESLPNGMFQVRLDNGDLVLGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.122 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDKVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.103 kDa

MKEQKLIHEGLIIESLPNGMFRVRLDNEDLILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.137 kDa

MKEEKWIHEGLITESLPNGMFRVRLDNEDLVLGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSKD

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.274 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDFILGYISGRIRRSFIRILPGDRVKIEISRYDSTRGRIIYRLRNKDSNY

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.122 kDa

MKEQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKIEVSRYDSSRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.106 kDa

MKEQKLIHEGLITESLPNGMFWVRLDNEDLVLGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.021 kDa

MKEQKLIHEGLITESLPNGMFRVRLDNEDLILGYVSGRIRRSFIRILPGDRVKIEVSSYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.122 kDa

MKEQKLIHEGLITESLPNGMFRVRLDNEKMILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

77 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

9.164 kDa

MKEQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRLRNKDSND

infA

Translation initiation factor IF-1

76 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.853 kDa

MEDMAKKDGVIEIEGVVTEALPNAMFRVELTNKHIVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

76 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.662 kDa

MAKKDVVVMQGYIIEALPNANFKVKLDNGHEILAHISGRMRKNFIKILPGDRVTVEVSVYDLNKGRIVKREKVNKD

infA

Translation initiation factor IF-1, chloroplastic

75 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.948 kDa

MKEQKRISESLITESLTNDMFWVCLENEDPILGYVSGRIRHSFIHILVKISVSCYDSTRTRRRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

75 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.948 kDa

MKEQKRISESLITESLTNDMFWVCLENEDPILGYVSGRIRHSFIHILVKISVSCYDSTRTRRRIIYRLRNKDSND

infA

Translation initiation factor IF-1, chloroplastic

75 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.493 kDa

MKKQNLIHAEGLVTESLPNGMFRVLTDNGCQILTHISGRIRRNSVRILPGDRVKVELSAYDLTKGRIIYRLSNKS

infA

Translation initiation factor IF-1

75 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.666 kDa

MANLPKEQKLLFQGKVTHVFNAQEYEVTLENGIKLNCHIAGKMKIHHIKIIIGDMVKVEISPYDLSKGRIVYRFK

infA

Translation initiation factor IF-1

75 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.666 kDa

MANLPKEQKLLFQGKVTHVFNAQEYEVTLENGIKLNCHIAGKMKIHHIKIIIGDMVKVEISPYDLSKGRIVYRFK

infA

Translation initiation factor IF-1

75 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.666 kDa

MANLPKEQKLLFQGKVTHVFNAQEYEVTLENGIKLNCHIAGKMKIHHIKIIIGDMVKVEISPYDLSKGRIVYRFK

infA

Translation initiation factor IF-1

75 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.681 kDa

MSKQDLIEMEGTVMESLPNAMFRVDLDNGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLKNKK

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.507 kDa

MAKQDAIEMEGTVTESLPNAMFRVDLDNGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLRKK

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.574 kDa

MAKKDDIIEFEGEVIDTLPNTLFKVRLENGHEIIAHISGKMRKHYIRILTGDKVKVEMTPYDLTKGRITYRGKT

infA

Translation initiation factor IF-1, chloroplastic

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.729 kDa

MEKQNIIEMEGVITESLPNAMFRVHLDNGFDVLAHISGKIRRNYIRILPGDRVKIEMTPYDLTKGRITYRLRKR

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.565 kDa

MSKQDLIEMEGTVTESLPNAMFRVDLDNGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLRKK

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.484 kDa

MSNKEDIIKMEGTIVEALPNAMFRVELENGHKILAHISGKMRKNFIRLVPGDKVVVELTIYDLTKGRIVYRKKS

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.589 kDa

MGKEDVIRMEGTIIEALPNAMFRVELDNGHKVLAHVSXRMRKNFIRLVPGDRVIVELSVYDLTRGRIVYRKKPE

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.535 kDa

MGKEDVIRMEGTIIEALPNAMFRVELDNGHKVLAHVSGRMRKNFIRLVPGDRVIVELSVYDLTRGRIVYRKKPE

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.565 kDa

MSKQDLIEMEGTVTESLPNAMFRVDLDNGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLRKK

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.384 kDa

MADTEKLKMLGKIVEVLQGGNFRVQLENGITIMSHVSGKMRVNKINILPGDTVDVELSPYDLTRGRITYRHRDN

infA

Translation initiation factor IF-1, chloroplastic

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.729 kDa

MEKQNIIEMEGVITESLPNAMFRVHLDNGFDVLAHISGKIRRNYIRILPGDRVKIEMTPYDLTKGRITYRLRKR

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.565 kDa

MSKQDLIEMEGTVTESLPNAMFRVDLDNGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLRKK

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.484 kDa

MSNKEDIIKMEGTIVEALPNAMFRVELENGHKILAHISGKMRKNFIRLVPGDKVVVELTIYDLTKGRIVYRKKS

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.589 kDa

MGKEDVIRMEGTIIEALPNAMFRVELDNGHKVLAHVSXRMRKNFIRLVPGDRVIVELSVYDLTRGRIVYRKKPE

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.535 kDa

MGKEDVIRMEGTIIEALPNAMFRVELDNGHKVLAHVSGRMRKNFIRLVPGDRVIVELSVYDLTRGRIVYRKKPE

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.565 kDa

MSKQDLIEMEGTVTESLPNAMFRVDLDNGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLRKK

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.384 kDa

MADTEKLKMLGKIVEVLQGGNFRVQLENGITIMSHVSGKMRVNKINILPGDTVDVELSPYDLTRGRITYRHRDN

infA

Translation initiation factor IF-1, chloroplastic

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.738 kDa

MERQNLIEMEGVITESLPNAMFRVHLDNGFNVLAHISGKIRRNYIRILPGDRVKIELTPYDLTKGRITYRLRKR

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.418 kDa

MAKETEMEFEGTVVEVLPNAQFKVKLENGVVINAHVSGKIRMHYIRILPGDKVTIVISPYDMTRGRITYRKIGK

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.565 kDa

MSKQDLIEMEGTVTESLPNAMFRVDLDNGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLRKK

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.461 kDa

MSKEDAIEVEGVVTESLPNAMFRVDLDNGFNVLAHISGKIRRNYIKILPGDRVKVELSPYDLNKGRITYRLKKK

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.493 kDa

MSKEDAIEMEGVVTESLPNAMFRVDLDNGFNVLAHISGKIRRNYIKILPGDRVKVELSPYDLNKGRITYRLKKK

infA

Translation initiation factor IF-1

74 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.505 kDa

MSKQDAIEIEGTVTESLPNAMFRVDLDNGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLRKK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.505 kDa

MANKEELIEFEGVVTETLPNTMFRVRLENGHEVIAHISGKMRKHYIRILTGDNVKVEMTPYDLSKGRITYRAR

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.492 kDa

MANKEELIEFEGVVTETLPNTMFRVRLENGHEVIAHISGKMRKHYIRILTGDSVKVEMTPYDLTKGRITYRAR

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.431 kDa

MAKKDGVIEIEGQVIEPLPNAMFRVELANGHKVLAHISGKMRMHYIRILPGDRVVVELSPYDLNRGRIVYRYR

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.463 kDa

MAKQDVIEMEGTVVESLPNAMFRVELDNSFNILAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLRK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.459 kDa

MAKDEIIEFEGEVIDTLPNTLFKVRLENGHEIIAHISGKMRKHYIRILTGDKVKVEMTPYDLSKGRITYRGKN

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.459 kDa

MAKDEIIEFEGEVIDTLPNTLFKVRLENGHEIIAHISGKMRKHYIRILTGDKVKVEMTPYDLSKGRITYRGKN

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.448 kDa

MPKKEGVIEIEGTVVEALPNAMFRVELSNGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.464 kDa

MAKKDGVIEIEGVVTEALPNAMFRVELTNKHVVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.427 kDa

MAKKDGAIEIEGTVIESLPNAMFRVELDNGHKVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.376 kDa

MAKKDGVIELEGSVLEALPNATFRVELSNGHKVLAHISGRMRQHYIRILPEDRVVVELSPYDLARGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.376 kDa

MAKKDGVIELEGSVLEALPNATFRVELSNGHKVLAHISGRMRQHYIRILPEDRVVVELSPYDLARGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.448 kDa

MPKKEGVIEIEGTVVEALPNAMFRVELSNGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.464 kDa

MAKKDGVIEIEGVVTEALPNAMFRVELTNKHVVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.427 kDa

MAKKDGAIEIEGTVIESLPNAMFRVELDNGHKVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.376 kDa

MAKKDGVIELEGSVLEALPNATFRVELSNGHKVLAHISGRMRQHYIRILPEDRVVVELSPYDLARGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.376 kDa

MAKKDGVIELEGSVLEALPNATFRVELSNGHKVLAHISGRMRQHYIRILPEDRVVVELSPYDLARGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.542 kDa

MPKKDGAIEIEGRVVEPLPNAMFRVELQNGHRVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.542 kDa

MPKKDGAIEIEGRVVEPLPNAMFRVELQNGHRVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.215 kDa

MSKKDVIELEGTIVEALPNAMFKVELENGHTILGHISGKMRMNYIKILPGDGVTVQISPYDLSRGRIVYRKKN

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.417 kDa

MGKKEEAFEVEGTVTQALANTRFRVQLETGNEVMAHVAGRMRKHFIRIVPGDKVRVELSPYDLTKGRIVYRER

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.286 kDa

MSKDDLIQFTGTVIELAPNATFRVKLENGHVIIAHTAGRMRKNRIRILLGDKVTVEMTPYDLTKGRVILRHQS

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.286 kDa

MSKDDLIQFTGTVIELAPNATFRVKLENGHVIIAHTAGRMRKNRIRILLGDKVTVEMTPYDLTKGRVILRHQS

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.469 kDa

MIMSKDDLIQFTGTVLELLPNATFRVKLENDHVIIAHTAGRMRKNRIRILLGDKVMVEMTPYDLTKGRVIHRH

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.378 kDa

MAKKDGVIEIEGGVVEALPNAMFRVELSNGHKVLAHISGKMRQHYIRILPEDRVIVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.378 kDa

MAKKDGVIEIEGGVVEALPNAMFRVELSNGHKVLAHISGKMRQHYIRILPEDRVIVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.503 kDa

MAKKDGAIEVEGRVIEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.538 kDa

MSKKKDVIEMEGTITEPLPNAMFRVQLDNGHEVLAHISGKMRMNYIRILKGDRVLVELSPYDLTRGRITYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.368 kDa

MAKKEDTIVLEGRVKELLPGMHFKILLENGMPVTAHLCGKMRMSNIRLLVGDRVTVEMSAYDLTKARVVYRHR

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.368 kDa

MAKKEDTIVLEGRVQELLPGMHFKILLENGMPVTAHLCGKMRMSNIRLLVGDRVTVEMSAYDLTKARVVYRHR

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.368 kDa

MAKKEDTIVLEGRVQELLPGMHFKILLENGMPVTAHLCGKMRMSNIRLLVGDRVTVEMSAYDLTKARVVYRHR

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.413 kDa

MAKKEDTIVLEGRVEELLPGMHFRVMLENGVPITAHLCGKMRMSNIRLLVGDRVTVEMSTYDLTKARVVYRHR

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.355 kDa

MAKKEDTLVLEGKVEELLPGMHFRVILENGMPVTAHLCGKMRMSNIRLLVGDRVTVEMSAYDLTKARVVYRHR

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.413 kDa

MAKKEDTIVLEGRVEELLPGMHFRVMLENGVPITAHLCGKMRMSNIRLLVGDRVTVEMSTYDLTKARVVYRHR

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.413 kDa

MAKKEDTIVLEGRVEELLPGMHFRVMLENGVPITAHLCGKMRMSNIRLLVGDRVTVEMSTYDLTKARVVYRHR

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.489 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.503 kDa

MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.411 kDa

MAKKQGAIEIEGTVVESLPNAMFKVELQNGHQVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.476 kDa

MDIKEEAIETEGIVKESLPNTMFRVELKNKHIVLAHLSGKMRKHFIKIVPGDKVKVELSPYDLTKGRIVYREK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.475 kDa

MNIKEEAIETEGIVKESLPNTMFRVELKNKHIVLAHLSGKMRKHFIKIVPGDKVKVELSPYDLTKGRIVYREK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.475 kDa

MNIKEEAIETEGIVKESLPNTMFRVELKNKHIVLAHLSGKMRKHFIKIVPGDKVKVELSPYDLTKGRIVYREK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.434 kDa

MPKKDGVIEIEGTVIEALPNAMFRVELSNGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.274 kDa

MAKDDVIEVEGKVVDTLPNAMFKVELENGATILAHVSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRFIK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.274 kDa

MAKDDVIEVEGKVVDTLPNAMFKVELENGATILAHVSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRFIK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.274 kDa

MAKDDVIEVEGKVVDTLPNAMFKVELENGATILAHVSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRFIK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.288 kDa

MAKEDVIEVEGKVVDTLPNAMFKVELENGATILAHVSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRFIK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.274 kDa

MAKDDVIEVEGKVVDTLPNAMFKVELENGATILAHVSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRFIK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.288 kDa

MAKEDVIEVEGKVVDTLPNAMFKVELENGATILAHVSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRFIK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.58 kDa

MSKKKDVIEMEGTITEPLPNAMFRVKLENGHEVLAHISGRMRMNYIRILKGDRVLVELSPYDLTRGRITYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.58 kDa

MSKKKDVIEMEGTITEPLPNAMFRVKLENGHEVLAHISGRMRMNYIRILKGDRVLVELSPYDLTRGRITYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.421 kDa

MAKEDVIEVEGTVTEALPNTQFRVELDNGHNVLAHISGKMRMNYIRILPGDRVKVELSPYDLSRGRITYRYRS

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.485 kDa

MPKKDGAIEIEGRVIEPLPNAMFRVELANGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.423 kDa

MAKEEAIEKDGEVIEALPNAQFRVRLENGHEILGLLSGKMRMNYIKILPGDRVKVEMSPYDLSKGRIVYRYKN

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.153 kDa

MSEKEAGIEVQGTVEEALAGGMYRVKVDQGPVVLAYASGKMKKFHIRIIPGDRVKLELSPYDLSRGRITYRDK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.169 kDa

MSEKEAGIEVQGTVEEALAGGMYRVKVDQGPTVLAYASGKMKKFHIRIIPGDRVKLELSPYDLTRGRITYRDK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.478 kDa

MAKKDGVIEIEGVVTEALPNAMFRVELTNKHIVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.342 kDa

MAKEDHIEMAGTVIDTLPNTMFRVELENGHIVTAHISGRMRKNYIRILTGDKVKVELTPYDLSKGRIIFRDKG

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.342 kDa

MAKEDHIEMAGTVIDTLPNTMFRVELENGHIVTAHISGRMRKNYIRILTGDKVKVELTPYDLSKGRIIFRDKG

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.342 kDa

MAKEDHIEMAGTVIDTLPNTMFRVELENGHIVTAHISGRMRKNYIRILTGDKVKVELTPYDLSKGRIIFRDKG

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.342 kDa

MAKEDHIEMAGTVIDTLPNTMFRVELENGHIVTAHISGRMRKNYIRILTGDKVKVELTPYDLSKGRIIFRDKG

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.436 kDa

MAKKDGVIEIEGSVIEALPNAMFRVELTNGHKVLAHISGKMRQHYIRILPEDRVIVELSPYDLTRGRIVYRYK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.359 kDa

MAKKEGALELEGTVVEALPNAMFRVELKNGHRVLATISGKMRQHYIRILPSDRVVVELSPYDLTRGRIVYRHK

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.248 kDa

MPKKDAIEVEATVLEALPSAAFRVQLSNGHEVLAHISGKMRVHYIRILPGDRVLVELSPYDLTRGRVTYRFKS

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.248 kDa

MPKKDAIEVEATVLEALPSAAFRVQLSNGHEVLAHISGKMRVHYIRILPGDRVLVELSPYDLTRGRVTYRFKS

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.248 kDa

MPKKDAIEVEATVLEALPSAAFRVQLSNGHEVLAHISGKMRVHYIRILPGDRVLVELSPYDLTRGRVTYRFKS

infA

Translation initiation factor IF-1

73 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.307 kDa

MAKEDAIEVEGTVVETLPNAMFRVELPNGHRILAHISGKMRMHFIRILPGDKVTVELSPYDLNRGRITYRSKS

infA

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.25 kDa

MAKEDNIEMQGTVLETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRSR

infA

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.342 kDa

MAKEEVLEFPGVVTELLPNATFRVKLENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK

infA

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.236 kDa

MAKEDNIEMQGTVLDTLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRSR

infA

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.245 kDa

MSKEDSIEVTGTVLEKFPSGLFSVQLEHERVVLAHLAGRLRRNRIRVLAGDKVTLELSPYDLTKGRITFRHR

infA

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.411 kDa

MAKEELLEMRGQVVELLPNAMFRVKLENDHEILGHTAGKMRKNRIRVLVGDEVLVELTPYDLTKGRITYRFK

infA

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.411 kDa

MAKEELLEMRGQVVELLPNAMFRVKLENDHEILGHTAGKMRKNRIRVLVGDEVLVELTPYDLTKGRITYRFK

infA

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.167 kDa

MAKTDLLEVQGTILEVLPNTMFKVQLKNGATILAHVSGKIRMNYIRILPGDTVVVEMSPYDLERGRIVFRHK

infA

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.28 kDa

MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK

infA

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.28 kDa

MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK

infA

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.28 kDa

MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK

infA

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.28 kDa

MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK

infA

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.

8.28 kDa

MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK

infA

Translation initiation factor IF-1

72 amino acids

One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.

Belongs to the IF-1 family.