IMG2

54S ribosomal protein IMG2, mitochondrial

146 amino acids

Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane.

Belongs to the mitochondrion-specific ribosomal protein mL49 family.

16.38 kDa

MISSCVTRCFGRGKCLPGPATASIYQTIRCISTNSNKAAEAPIFPKLEDVKMHELIGNNNFGKKTYYVERSRTGNLPVYSAYKNGGNKIITEIRKIEGDVIQLRNDLQEQLPFIPKKSWSVVMQSKKIIIKGNAVEAVKRVLTKKF

img2

54S ribosomal protein img2, mitochondrial

105 amino acids

Belongs to the mitochondrion-specific ribosomal protein mL49 family.

12.091 kDa

MRSSLKPVLSNLRFNSTIASESLRFHVSRTPSKNLPVYLDYKQRGTKILTLIRKIHGDSNALRLRLISTLKMSPKDVYVNKLTNQVVLKGNHIVTVREWLQDQGF