ihfB

Integration host factor subunit beta

138 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

15.018 kDa

MTKSELVEKLAARFPQLLLRDADIAVKTILDAMSDALADGHRIEIRGFGSFGLNRRPPRVGRNPKSGEKVLVPEKRVPHFKAGKELRERVDRSLERQGDSSSEGEPVSLTAVKAARQAGGHHAAGFPAEATPTLVMSR

ihfB

Integration host factor subunit beta

137 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

14.521 kDa

MTKSELVEKLAARFPQLLLRDADISVKTILDAMSDALADGHRIEIRGFGSFGLNRRPPRVGRNPKSGERVLVPEKRVPHFKAGKELRERVDRNLTPSSGGSGNGHLTGTPSGKGPQGAAPGSPAVLHEGGGLNLARS

ihfB

Integration host factor subunit beta

135 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

14.683 kDa

MTKSELVEKLAARFPQLLLRDADISVKTILDAMSEALADGHRIEIRGFGSFGLNKRPPRVGRNPKSGERVLVPEKRVPHFKAGKELRERVDRTVTQGGGMNGNGHAPHGKTGQSQLGSQSPASLHDDGQLNLVRS

ihfB

Integration host factor subunit beta

119 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

12.942 kDa

MTKSELIAALAARYPQLAARDTDYAVKTMLDAMTQALASGQRIEIRGFGSFSLSQRSPRIGRNPKSGEQVLVPGKQVPHFKAGKELRERVDLVGNDQGDDSSNGSSDPLQSVMDMHAMH

ihfB

Integration host factor subunit beta

119 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

12.783 kDa

MTKSELIAALAARYPQLAARDTDYAVKTMLDAMTQALASGQRIEIRGFGSFSLSQRSPRVGRNPKSGEQVLVPGKQVPHFKAGKELRERVDLAGGLADTQPDGDAPDQPQPTLLGLHAM

ihfB

Integration host factor subunit beta

110 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

12.312 kDa

MIKSELVARLAQANPHLYQRDVERIVSTIFDEISAALARGDRVELRGFGAFSVKSRPARTGRNPRTGEPVHVDEKSVPFFKTGKELRERLNNADIADDKLMVDDSDDGDD

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.918 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKHVPHFKPGKELRERVDGRAGEPLKNDEPEDAQ

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.918 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKHVPHFKPGKELRERVDGRAGEPLKNDEPEDAQ

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.918 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKHVPHFKPGKELRERVDGRAGEPLKNDEPEDAQ

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.904 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKHVPHFKPGKELRERVDGRAGEPLKNDEPEDGQ

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.969 kDa

MTKSELVAQLALRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKFVPHFKPGKELRERVDGRAGEPLKADDPDDER

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.848 kDa

MTKSELVAQLATRFPQLVLKDADFAVKTMLDAMSDALANGHRIEIRGFGSFGLNRRPSRVGRNPKSGEKVLVPEKHVPHFKPGKELRERVDRNAGEPLKADAADDDL

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.998 kDa

MTKSELVAQLAARFPQLVLKDADFAVKTMLDAMSEALANGHRIEIRGFGSFGLNRRPSRVGRNPKSGEKVLVPEKYVPHFKPGKELRERVDRRAGEPLKAEEPDDDL

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

12.014 kDa

MTKSELVAQLATRFPQLVLKDADFAVKTMLDAMSEALANGHRIEIRGFGSFGLNRRPSRVGRNPKSGEKVLVPEKYVPHFKPGKELRERVDRRAGEPLKAEDPDDDL

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.969 kDa

MTKSELVAQLALRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKFVPHFKPGKELRERVDGRAGEPLKADDPDDER

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.913 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALAKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKFVPHFKPGKELRERVDGRAGEPLKADDPDDDR

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.913 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALAKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKFVPHFKPGKELRERVDGRAGEPLKADDPDDDR

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.913 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALAKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKFVPHFKPGKELRERVDGRAGEPLKADDPDDDR

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.927 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALAKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKFVPHFKPGKELRERVDGRAGEPLKADDPDDER

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.969 kDa

MTKSELVAQLALRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKFVPHFKPGKELRERVDGRAGEPLKADDPDDER

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.927 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALAKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKFVPHFKPGKELRERVDGRAGEPLKADDPDDER

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.957 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKFVPHFKPGKELRERVDGRAGEPLKADEPDDER

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.918 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKHVPHFKPGKELRERVDGRAGEPLKNDEPEDAQ

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.918 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKHVPHFKPGKELRERVDGRAGEPLKNDEPEDAQ

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.918 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKHVPHFKPGKELRERVDGRAGEPLKNDEPEDAQ

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.918 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKHVPHFKPGKELRERVDGRAGEPLKNDEPEDAQ

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.918 kDa

MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQVPEKHVPHFKPGKELRERVDGRAGEPLKNDEPEDAQ

ihfB

Integration host factor subunit beta

107 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.587 kDa

MTKSELIASLKADNPHLTERDVETIVSTIFDEISNALARGARVELRGFGAFTIKRRDARVGRNPRTGETVSVDEKVVPFFKAGKELRERVNNGTRKNGGSADAASGG

ihfB

Integration host factor subunit beta

106 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.832 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILEEIVSALARGDRVELRGFGAFSVKHRPARAGRNPRTGEHVPVEQKSVPFFKTGKEMRERLNRDGLDGATPPSPPAA

ihfB

Integration host factor subunit beta

105 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.74 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRDNPEGAAADDADD

ihfB

Integration host factor subunit beta

105 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.869 kDa

MTKSELISKLAERFPQLLAKDAELVVKIILDAMAKSLARGERIEIRGFGSFDLNYRPSRVGRNPKSGEKVHVPEKYVPHFKAGKKMRELIDSSHKQHNLLDQATG

ihfB

Integration host factor subunit beta

105 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.871 kDa

MTKSELISKLAERFPQLLAKDAELVVKIILDAMAKSLSRGERIEIRGFGSFDLNYRPSRVGRNPKSGEKVHVPEKYVPHFKAGKKMRELIDSGPKQHKVLDRVTG

ihfB

Integration host factor subunit beta

104 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.643 kDa

MTKSELIARLSERLAERNSQLVYKDAELAVKTILDAMANNLAQGSRIEIRGFGSFDLNYRPPRVGRNPKSGASVSVPEKYVPHFKAGKELRERVDLSLLEQTQA

ihfB

Integration host factor subunit beta

104 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.674 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVPVDQKTVPFFKTGKEMRERLNRDSGDDAPTSDTA

ihfB

Integration host factor subunit beta

104 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.674 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVPVDQKTVPFFKTGKEMRERLNRDSGDDAPTSDTA

ihfB

Integration host factor subunit beta

104 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.674 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVPVDQKTVPFFKTGKEMRERLNRDSGDDAPTSDTA

ihfB

Integration host factor subunit beta

104 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.674 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVPVDQKTVPFFKTGKEMRERLNRDSGDDAPTSDTA

ihfB

Integration host factor subunit beta

104 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.463 kDa

MTKSELIEILTKRQAHLKSDDVDLAVKSLLEMMGGALSEGDRIEIRGFGSFSLHYRPPRCGRNPKTGESVALPGKYVPHFKPGKELRERVASVVPLAECGDITE

ihfB

Integration host factor subunit beta

104 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.377 kDa

MTKSELIEILTKRQAHLKSDDVDLAVKSLLEMMGGALSGGDRIEIRGFGSFSLHYRPPRCGRNPKTGESVALPGKYVPHFKPGKELRERVASVVPLGECGDITE

ihfB

Integration host factor subunit beta

104 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.377 kDa

MTKSELIEILTKRQAHLKSDDVDLAVKSLLEMMGGALSGGDRIEIRGFGSFSLHYRPPRCGRNPKTGESVALPGKYVPHFKPGKELRERVASVVPLGECGDITE

ihfB

Integration host factor subunit beta

104 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.804 kDa

MTKSELMVRLAEVFAAKNGTHLLAKDVEYSVKVLVDTMTRSLARGQRIEIRGFGSFDLNHRPARIGRNPKTGERVEVPEKHVPHFKPGKELRERVDLALKENAN

ihfB

Integration host factor subunit beta

104 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.804 kDa

MTKSELMVRLAEVFAAKNGTHLLAKDVEYSVKVLVDTMTRSLARGQRIEIRGFGSFDLNHRPARIGRNPKTGERVEVPEKHVPHFKPGKELRERVDLALKENAN

ihfB

Integration host factor subunit beta

104 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.804 kDa

MTKSELMVRLAEVFAAKNGTHLLAKDVEYSVKVLVDTMTRSLARGQRIEIRGFGSFDLNHRPARIGRNPKTGERVEVPEKHVPHFKPGKELRERVDLALKENAN

ihfB

Integration host factor subunit beta

104 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.804 kDa

MTKSELMVRLAEVFAAKNGTHLLAKDVEYSVKVLVDTMTRSLARGQRIEIRGFGSFDLNHRPARIGRNPKTGERVEVPEKHVPHFKPGKELRERVDLALKENAN

ihfB

Integration host factor subunit beta

103 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.551 kDa

MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDSVFVEEKWVPFFKTGKELRERLNPGMNGNDNGEDD

ihfB

Integration host factor subunit beta

103 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.612 kDa

MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALASGNRVELRGFGAFSVKNRPSRTGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGMDDEDDGDAD

ihfB

Integration host factor subunit beta

103 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.612 kDa

MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALASGNRVELRGFGAFSVKNRPSRTGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGMDDEDDGDAD

ihfB

Integration host factor subunit beta

103 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.608 kDa

MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDSVFVEEKWVPFFKTGKELRERLNPGMNDNNNGEDD

ihfB

Integration host factor subunit beta

103 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.526 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRDNPAGAADTDD

ihfB

Integration host factor subunit beta

103 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.373 kDa

MTKSELIEILARRQAHLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVALPGKHVPHFKPGKELRERVSSVVPVDVADTAD

ihfB

Integration host factor subunit beta

103 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.403 kDa

MTKSELIEILARRQAHLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVALPGKHVPHFKPGKELRERVSSVVPVDMVDAAD

ihfB

Integration host factor subunit beta

103 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.403 kDa

MTKSELIEILARRQAHLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVALPGKHVPHFKPGKELRERVSSVVPVDMVDAAD

ihfB

Integration host factor subunit beta

103 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.403 kDa

MTKSELIEILARRQAHLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVALPGKHVPHFKPGKELRERVSSVVPVDMVDAAD

ihfB

Integration host factor subunit beta

103 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.451 kDa

MTKSELIEILARRQAHLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVALPGKHVPHFKPGKELRERVSSVVPVDMSDTTD

ihfB

Integration host factor subunit beta

103 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.451 kDa

MTKSELIEILARRQAHLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVALPGKHVPHFKPGKELRERVSSVVPVDMSDTTD

ihfB

Integration host factor subunit beta

102 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.45 kDa

MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGAGDEDDDDN

ihfB

Integration host factor subunit beta

102 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.564 kDa

MIKSELVDFVAAKNPYLHRRDAENAVDAVLDEITGALERGERVDIRSFGTFVVRHRPARSGRNPLNGNAVFIEEKWVPFFRAGKEIRDRLNTAEKSQGRGNL

ihfB

Integration host factor subunit beta

102 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.485 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILEEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGEHVPVEQKSVPFFKTGKEMRERLNRDNGISAETGA

ihfB

Integration host factor subunit beta

102 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.45 kDa

MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGAGDEDDDDN

ihfB

Integration host factor subunit beta

102 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.564 kDa

MIKSELVDFVAAKNPYLHRRDAENAVDAVLDEITGALERGERVDIRSFGTFVVRHRPARSGRNPLNGNAVFIEEKWVPFFRAGKEIRDRLNTAEKSQGRGNL

ihfB

Integration host factor subunit beta

102 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.485 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILEEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGEHVPVEQKSVPFFKTGKEMRERLNRDNGISAETGA

ihfB

Integration host factor subunit beta

102 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.564 kDa

MIKSELVDFVAAKNPYLHRRDAENAVDAVLDEITGALERGERVDIRSFGTFVVRHRPARSGRNPLNGNAVFIEEKWVPFFRAGKEIRDRLNTAEKSQGRGNL

ihfB

Integration host factor subunit beta

102 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.526 kDa

MTKSELIEAIASKQPHLAHKDVEDAVKKMLEHMSETLANGKRIEIRGFGSFSLHHRPARMGRNPKTGEPVALPAKYVPHFKPGKELRERVNSSRHQAPLRSQ

ihfB

Integration host factor subunit beta

102 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.567 kDa

MTKSELIELLIDQQSHLPVKDVEQAIKAMLEHMSDSLANGERIEIRGFGSFSLHYRAPRIGRNPKTGESVELSAKYVPHFKPGKELRELVNLPENSEINELN

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.068 kDa

MTKSELIEILARRQAHLKADDVDLAVKSLLEMMGGSLSAGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVALPGKHVPHFKPGKELRERVSSVLPLDADPA

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.375 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRETGDTDTGA

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.255 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRDTGAPDSGA

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.37 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNREPGNTDTGA

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.375 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRETGDTDTGA

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.255 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRDTGAPDSGA

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.37 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNREPGNTDTGA

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.373 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILEEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRDHPDPGAAD

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.068 kDa

MTKSELIEILARRQAHLKADDVDLAVKSLLEMMGGSLSAGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVALPGKHVPHFKPGKELRERVSSVLPLDADPA

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.26 kDa

MTKSELIARLAERYPQLVAKDADYAVKTILDAMSDALATGQRIEIRGFGSFALNSRPPRIGRNPKSGDKVMVPEKRVPHFKPGKQLRERVDAMVGQPIIED

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.26 kDa

MTKSELIARLAERYPQLVAKDADYAVKTILDAMSDALATGQRIEIRGFGSFALNSRPPRIGRNPKSGDKVMVPEKRVPHFKPGKQLRERVDAMVGQPIIED

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.415 kDa

MIKSELIDQLAEANPHLYHRDVERVVNTILDGITDALARGERVELRGFGAFSVRHRPARVGRNPRTGESVAVKEKHVPFFKTGKELRERVDASRESNPEIA

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.432 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVTALARGDRVELRGFGAFSVKHRPARAGRNPRTGEHVPVDQKSVPFFKTGKEMRERLNRENATSEASA

ihfB

Integration host factor subunit beta

101 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.415 kDa

MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGEHVPVDQKSVPFFKTGKEMRERLNRDNATSEANA

ihfB

Integration host factor subunit beta

100 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.295 kDa

MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGESVFVEEKWVPFFKTGKELRERLNPGMGDEEDD

ihfB

Integration host factor subunit beta

100 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.296 kDa

MTKSELIARIAERNPHLYQRDVERIVSTIFDEIADALARGDRVELRGFGAFSVKRRDARMGRNPRTGETVDVDAKVAPYFKTGKQLRELLNGGESESDDD

ihfB

Integration host factor subunit beta

100 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.295 kDa

MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGESVFVEEKWVPFFKTGKELRERLNPGMGDEEDD

ihfB

Integration host factor subunit beta

100 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.296 kDa

MTKSELIARIAERNPHLYQRDVERIVSTIFDEIADALARGDRVELRGFGAFSVKRRDARMGRNPRTGETVDVDAKVAPYFKTGKQLRELLNGGESESDDD

ihfB

Integration host factor subunit beta

100 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.332 kDa

MTKSELIERIVTHQGLLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVSLEGKFVPHFKPGKELRDRVNEDEHEEAHT

ihfB

Integration host factor subunit beta

100 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.332 kDa

MTKSELIERIVTHQGLLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVSLEGKFVPHFKPGKELRDRVNEDEHEEAHT

ihfB

Integration host factor subunit beta

100 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.166 kDa

MTKSELIEVIAGKQQHLAHKDVELAVKTLLEQMSETLASGERIEIRGFGSFSLHHRPPRIGRNPKTGEPVALPGKYVPHFKPGKELRDRVNAGRHNPIQS

ihfB

Integration host factor subunit beta

99 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.191 kDa

MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGQADEED

ihfB

Integration host factor subunit beta

99 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.191 kDa

MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGQADEED

ihfB

Integration host factor subunit beta

99 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.191 kDa

MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGQADEED

ihfB

Integration host factor subunit beta

99 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.191 kDa

MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGQADEED

ihfB

Integration host factor subunit beta

99 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.038 kDa

MTKSELIARLAERYPHLVAKDTELAVKTILDAMAVSLASGQRIEIRGFGSFDLNYRPPRTGRNPKSGSSVHVPEKFVPHFKAGKELRERVDTSSMLQEA

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.906 kDa

MTKSELIEQIAIRQPELSAKEVEAAVKIILEDITQSLSSGGRVEIRGFGSFSLHFREPRTGRNPKTGDPVDLQGKYVPHFKPGKELREQVNASRALGY

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.104 kDa

MTKSELIERIVTHQGLLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGRSVSLDGKFVPHFKPGKELRDRVNEDEEEGF

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.114 kDa

MTKSELIDRIVTHQGLLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVSLEGKYVPHFKPGKELRDRVNEEEHVPH

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.028 kDa

MTKSELIERIVTHQGLLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVSLDGKFVPHFKPGKELRDRVNEDEEEGV

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.077 kDa

MTKSELIERIAERQDQLSAKDIELAVKLVLEYMSQALSTGERIEIRGFGSFSLHFRAPRTGRNPKTGESVTLPGKYVPHFKPGKEMRDRVNESIQSEG

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.077 kDa

MTKSELIERIAERQDQLSAKDIELAVKLVLEYMSQALSTGERIEIRGFGSFSLHFRAPRTGRNPKTGESVTLPGKYVPHFKPGKEMRDRVNESIQSEG

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.028 kDa

MTKSELIERIVTHQGLLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVSLEGKFVPHFKPGKELRDRVNEEDEAEA

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.056 kDa

MTKSELIERIVTHQGLLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVSLDGKFVPHFKPGKELRDRVNEEEEGEL

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.028 kDa

MTKSELIERIVTHQGLLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVSLEGKFVPHFKPGKELRDRVNEEDEAEA

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.184 kDa

MTKSELIERIVTHQGLLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVELEGKFVPHFKPGKELRDRVNEEEHEHP

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.076 kDa

MTKSELIERIVTHQGLLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVSLDGKFVPHFKPGKELRDRVNEDEEEGF

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.076 kDa

MTKSELIERIVTHQGLLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVSLDGKFVPHFKPGKELRDRVNEDEEEGF

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.233 kDa

MTKSELIERIAERQDQLSAKDIELAVKLILEYMSQCLANGDRIEIRGFGSFSLHYRAPRTGRNPKTGESVELEGKFVPHFKPGKEMRDRVNESLEELP

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.751 kDa

MTKSELIAELAAANPHLLSRDVELIVQTIFSEISAALARGDRVELRGFGAFTVKKRDARTGRNPRTGEMVAVDEKVVPFFKAGKELRERVNNGAPAED

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.038 kDa

MTKSELVEIIAQKQPQLSIKDVELAVKTIIEYMSQSLSQGQRIEIRGFGSFSLHYRAPRVGRNPKTGETVHLPAKYVPHFKPGKELRDEVNASLKAGY

ihfB

Integration host factor subunit beta

98 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.915 kDa

MTKSELVELIASKQTQLSVKDVELAVKSIIEHMSQSLADGQRIEIRGFGSFSLHHRAARTGRNPKTGDAVQLPAKFVPHFKPGKELREQVNDSMKKGF

ihfB

Integration host factor subunit beta

97 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.191 kDa

MIKSELVQRIADRNPHLYLRDVEKIVNAILDEITRALSRGDRVELRGFGAFSVKRRDARLGRNPRTGAHVPVEEKSVPFFKTGKEMRERLNEGYLAE

ihfB

Integration host factor subunit beta

97 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.611 kDa

MIKSELFERITEKKTYIPAKIIEYVVKNILEYMSLSLEKGNRIEIRGFGSFSLHYRFARIGRNPKTGEKVYLKEKYVPHFKPGKQLRDRINNIYKKI

ihfB

Integration host factor subunit beta

96 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.603 kDa

MIKSELIARLANENPHLTQKDVERVVGVILERMIGALEDGGRVELRGFGALSVRSRPARTGRNPRTGEAVDVRAKHVPFFKSGKELRARLNADGDE

ihfB

Integration host factor subunit beta

96 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.603 kDa

MIKSELIARLANENPHLTQKDVERVVGVILERMIGALEDGGRVELRGFGALSVRSRPARTGRNPRTGEAVDVRAKHVPFFKSGKELRARLNADGDE

ihfB

Integration host factor subunit beta

96 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.278 kDa

MTKSELIERLVMKYPQLRAQDVEDTVKLMIERICHTLEKGDRVEIRGFGSFSLHYRESRQGRNPKTGESVRVPAKSIPYFRAGKELRERVDEEINQ

ihfB

Integration host factor subunit beta

96 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.729 kDa

MTKSELIERLCSQQTHLSAKQVEDAIKEILEHMAGTLAEGDRIEIRGFGSFSLHYRAPRVGRNPKTGDKVELDGKYVPHFKPGKELRDRVNAAIAA

ihfB

Integration host factor subunit beta

96 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.018 kDa

MTKSELIERLADKARHVPSRDVELAIKEMLEQMAQTLQKGERIEIRGFGSFSLHYRAPRVGRNPKTGETVELDGKHVPHFKPGKELRERVNEDLIA

ihfB

Integration host factor subunit beta

96 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.892 kDa

MTKSELIEILARKQSHLAYKDVELSVKTMLEHLSQALATGDRIEIRGFGSFSLHFRPPRVGRNPKTGETVSLPGKYVPHFKPGKELRERVNAVHEQ

ihfB

Integration host factor subunit beta

96 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.941 kDa

MIKSELVQRIADRNPHLYLRDVEKIVNAILDEITNALSRGDRVELRGFGAFSVKHRDARVGRNPRTGAHVSVDEKVVPFFKTGKEMRERLNNGVDD

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.692 kDa

MTKSELIEKLADKLSHLSAKEVEKSIKEILELMAQSLSKGERIEIRGFGSFSLHYRAPRVGRNPKTGESVELSGKYVPHFKPGKELRERVNLSVA

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.812 kDa

MIRSELIQIVADENPHLYQRDVERIVNTVFEEIIEAMSNGDRVELRGFGAFSVKHRDARTGRNPRTGEAVAVEAKSVPFFKTGKLLRDRLNGKED

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.69 kDa

MTKSELIEKLATRQSQLSAKEVEAAIKEMLEQMADTLEAGDRIEIRGFGSFSLHYRAPRTGRNPKTGTSVELEGKYVPHFKPGKELRERVDAINT

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.664 kDa

MTKSELIEKLATRQSQLSAKEVESAIKEMLEQMATTLEGGDRIEIRGFGSFSLHYRAPRTGRNPKTGTSVELEGKYVPHFKPGKELRERVDAINS

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.648 kDa

MTKSELIEKLATRQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVELEGKYVPHFKPGKELRERVDAVNV

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.72 kDa

MTKSELIEKLATRQSQLSAKEVEAAIKEMLEQMADTLETGDRIEIRGFGSFSLHYRAPRTGRNPKTGTSVELEGKYVPHFKPGKELRERVDAINT

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.678 kDa

MTKSELIEKLATRQSQLSAKEVESAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVELEGKYVPHFKPGKELRERVDAVNV

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.648 kDa

MTKSELIEKLATRQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVELEGKYVPHFKPGKELRERVDAVNV

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.649 kDa

MTKSELIEKLATRQSQMSAKEVESAIKEMLEQMAQTLEGGDRIEIRGFGSFSLHFRAPRTGRNPKTGTSVDLDGKYVPHFKPGKELRERVDAINA

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.648 kDa

MTKSELIEKLATRQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVELEGKYVPHFKPGKELRERVDAVNV

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.648 kDa

MTKSELIEKLATRQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVELEGKYVPHFKPGKELRERVDAVNV

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.678 kDa

MTKSELIEKLATRQSQLSAKEVESAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVELEGKYVPHFKPGKELRERVDAVNV

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.703 kDa

MTKSELIEKLAMRQSQLSAKEVESAIKEMLEQMAQTLEGGDRIEIRGFGSFSLHFRAPRTGRNPKTGTSVELDGKYVPHFKPGKELRERVDAINV

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.025 kDa

MIRSELIQKISEENPHLFQRDVERIVNTVFEEIIDAMARGDRVELRGFGAFSVKKRDARQGRNPRTGETVSVDEKHVPFFKTGKLLRERLNGLDE

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.784 kDa

MTKSELIERLAGLQSHLSAKTVEEAVKEMLDHMADTLADGERIEVRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRVNIYTE

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.605 kDa

MTKSELIETLAQQHAHVPVKDVENAVKEILEQMAGSLSSSDRIEIRGFGSFSLHYRAPRTGRNPKTGETVELDGKHVPHFKPGKELRDRVNESIA

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control. Involved in hydrogenase gene expression.

Belongs to the bacterial histone-like protein family.

10.81 kDa

MIRSELIAKIAEENPHLFQRDVEKIVNTIFEEIIEAMARGDRVELRGFGAFSVKKRDARTGRNPRTGTSVAVDEKHVPFFKTGKLLRDRLNGGEE

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.05 kDa

MIRSELIQKIADENPHLYQRDVERIVNTVFEEVTNAMSRGDRVELRGFGAFSVKKRDARVGRNPRTGETVHVEEKHVPFFKTGKLLRDRLNGKEE

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control. Involved in hydrogenase gene expression.

Belongs to the bacterial histone-like protein family.

10.81 kDa

MIRSELIAKIAEENPHLFQRDVEKIVNTIFEEIIEAMARGDRVELRGFGAFSVKKRDARTGRNPRTGTSVAVDEKHVPFFKTGKLLRDRLNGGEE

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

11.05 kDa

MIRSELIQKIADENPHLYQRDVERIVNTVFEEVTNAMSRGDRVELRGFGAFSVKKRDARVGRNPRTGETVHVEEKHVPFFKTGKLLRDRLNGKEE

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.752 kDa

MTKSELIERIVTHQGQLSSKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVRLDGKFVPHFKPGKELRDRVNEDES

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.682 kDa

MTKSDLIERLTSKHFQLSVKEVEDSVKETLTLMANSLAQGERIEVRGFGSFSLHYRAPRVGRNPKTGDRVELDGKYVPHFKPGKALRERVNAANA

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.692 kDa

MTKSELIEKLATRQSQLSAKEVESAVKEMLEQMATTLESGERIEIRGFGSFSLHYRAPRTGRNPKTGTSVELEGKYVPHFKPGKELRERVDAVNV

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.634 kDa

MTKSELIEKLATRQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVDLEGKYVPHFKPGKELRERVDAVNV

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.634 kDa

MTKSELIEKLATRQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVDLEGKYVPHFKPGKELRERVDAVNV

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.634 kDa

MTKSELIEKLATRQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVDLEGKYVPHFKPGKELRERVDAVNV

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.634 kDa

MTKSELIEKLATRQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVDLEGKYVPHFKPGKELRERVDAVNV

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.648 kDa

MTKSELIEKLATRQSQLSAKEVESAIKEMLEQMATTLEGGDRIEIRGFGSFSLHYRAPRTGRNPKTGTSVELDGKYVPHFKPGKELRERVDAVNV

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.69 kDa

MTKSELIEKLATRQSQLSAKEVESAIKEMLEQMATTLETGDRIEIRGFGSFSLHYRAPRTGRNPKTGTSVDLEGKYVPHFKPGKELRERVDAVNP

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.707 kDa

MTKSELIERLASQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVDLEGKYVPHFKPGKELRDRANIYGN

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.693 kDa

MTKSELIERLAGQQSHIPAKVVEDAVKEMLEHMATTLSEGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYGG

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.846 kDa

MIRSELIQKLSDENPHLYQRDVERIVNSIFEEVIDALAAGDRVELRGFGAFSVKKRDARIGRNPRTGESVSVEEKHVPFFKAGKLLRDRLNGHES

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.808 kDa

MTKSELIERLASQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYEE

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.736 kDa

MTKSELIERLASQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYEG

ihfB

Integration host factor subunit beta

95 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.678 kDa

MTKSELIESLAGKYPHLSPRDIEHAIKEMIGCMSEALAGGERIEIRGFGSFSLHHRPPRVGRNPKTGESVHLPSRRVPHFKPGKELRDRVNSIKD

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.417 kDa

MIKSELIARLANENPHLTQKDVERVVGVILERMIGALEDGGRVELRGFGALSVRSRPARAGRNPRTGETVDVRAKHVPFFKSGKELRGRLNADE

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.776 kDa

MIKSELVQTIANRNPHLFLRDVENIVNAIFDEITEALAQGNRVELRGFGAFSVKNRPARTGRNPRTGESVHVEEKWVPFFKTGKELRERLNADE

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.551 kDa

MTKSELIAQLAERFPQLVAKDADFAVKMILDAMSEALVRGDRIEIRGFGSFALNYRPPRVGRNPKSGEKVSVPAKWVPHFKAGKELRERVDQAI

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.567 kDa

MTKSELIERLAGQQSHIPAKVVEDAVKEMLEQMATTLASGDRIEIRGFGSFSLHYRAPRVGRNPKTGEKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.642 kDa

MTKSELIERLAGQHAHIQAKVVEDAVKEMLEHMATTLASGERIEIRGFGSFSLHYRAPRIGRNPKTGDRVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.682 kDa

MTKSELIERLVQKCHAVAAKDVENAVKEILDQMSFALESGKRIEVRGFGSFSLHYRQPRLGRNPKTGEQVKLDAKSVPHFKAGKELRERVDIYA

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.581 kDa

MTKSELIERLAGQQSHIPAKVVEDAVKEMLEQMASTLAEGDRIEIRGFGSFSLHYRAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.581 kDa

MTKSELIERLAGQQSHIPAKVVEDAVKEMLEQMASTLAEGDRIEIRGFGSFSLHYRAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.648 kDa

MTKSELIERLAGQQSHISAKTVEDAVKEILDHMAITLADGERIEVRGFGSFSLHYRAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRVNIYD

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.632 kDa

MTKSELIERIVTHQGQLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGESVRLDGKFVPHFKPGKELRDRVNEPE

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.632 kDa

MTKSELIERIVTHQGQLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGESVRLDGKFVPHFKPGKELRDRVNEPE

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.632 kDa

MTKSELIERIVTHQGQLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGESVRLDGKFVPHFKPGKELRDRVNEPE

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.632 kDa

MTKSELIERIVTHQGQLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGESVRLDGKFVPHFKPGKELRDRVNEPE

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.616 kDa

MTKSELIELLAKKNPSISTKIVENSVKEILEQMSGSLENSDRIEIRGFGSFSLHYRQPRLGRNPKTGESVKLDAKCVPHFKAGKELKERVDFKA

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.606 kDa

MTKSDLIEQLAASRMHMPAKDVEAAIKEILEQMASTLQNGDRIEIRGFGSFSLHYRAPRVGRNPKTGDKVELTGKYVPHFKPGKELRERVNIAE

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.648 kDa

MTKSDLIEQLAASRMHMPAKDVEAAIKEILEQMASTLQNGDRIEIRGFGSFSLHYRAPRVGRNPKTGDKVELTGKYVPHFKPGKELRERVNIIE

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.833 kDa

MIRSELIQKIADENPHLYQRDVERIVNTIFEEVTGAMARGDRVELRGFGAFSVKKRDARIGRNPRTGETVHVEEKHVPFFKTGKLLRDRLNGKS

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.847 kDa

MIRSELIQKIADENPHLYQRDVERIVNTVFEEVTDAMARGDRVELRGFGAFSVKKRDARIGRNPRTGDTVHVEEKHVPFFKTGKLLRDRLNGKA

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.607 kDa

MTKSELIERLASQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.616 kDa

MTKSELIELLAKKNPSISTKIVENSVKEILEQMSGSLENSDRIEIRGFGSFSLHYRQPRLGRNPKTGESVKLDAKCVPHFKAGKELKERVDFKA

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.606 kDa

MTKSDLIEQLAASRMHMPAKDVEAAIKEILEQMASTLQNGDRIEIRGFGSFSLHYRAPRVGRNPKTGDKVELTGKYVPHFKPGKELRERVNIAE

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.648 kDa

MTKSDLIEQLAASRMHMPAKDVEAAIKEILEQMASTLQNGDRIEIRGFGSFSLHYRAPRVGRNPKTGDKVELTGKYVPHFKPGKELRERVNIIE

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.833 kDa

MIRSELIQKIADENPHLYQRDVERIVNTIFEEVTGAMARGDRVELRGFGAFSVKKRDARIGRNPRTGETVHVEEKHVPFFKTGKLLRDRLNGKS

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.847 kDa

MIRSELIQKIADENPHLYQRDVERIVNTVFEEVTDAMARGDRVELRGFGAFSVKKRDARIGRNPRTGDTVHVEEKHVPFFKTGKLLRDRLNGKA

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.607 kDa

MTKSELIERLASQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.624 kDa

MIKSELVQIIATRNPHLFLRDVENIVGAIFDEITDALAEGNRVELRGFGAFSVKNRPARTGRNPRTGESVEVEEKWVPFFKTGKELRERLNGGK

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.546 kDa

MTKSELIERLAGQQSHVPTKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGAKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.56 kDa

MTKSELIERLAGQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.56 kDa

MTKSELIERLAGQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.56 kDa

MTKSELIERLAGQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.56 kDa

MTKSELIERLAGQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.56 kDa

MTKSELIERLAGQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.56 kDa

MTKSELIERLAGQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.56 kDa

MTKSELIERLAGQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.56 kDa

MTKSELIERLAGQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.56 kDa

MTKSELIERLAGQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.525 kDa

MIKSELVQKIAEANPHLYQRDVENIVNAILDQIVDALAQGDRVELRGFGAFSVKQREARTGRNPRTGKQVDVSSKVVPYFKTGKEMRERLNGAA

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.581 kDa

MTKSELIAQLAARFPQLVAKDADYAVKMILDAMSDALARGDRIEIRGFGSFALNYRPPRVGRNPKSGEKVHVPEKYVPHFKAGKELRERVDIVE

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.566 kDa

MIKSELVQIIASRNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVDVEEKWVPFFKTGKKLRDRLNGAV

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.566 kDa

MIKSELVQIIASRNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVDVEEKWVPFFKTGKKLRDRLNGAV

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.566 kDa

MIKSELVQIIASRNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVDVEEKWVPFFKTGKKLRDRLNGAV

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.567 kDa

MIKSELVQIIASRNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVDVEEKWVPFFKTGKELRDRLNGAV

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.536 kDa

MIKSELVQIIASRNPHLFQRDVVNIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVDVEEKWVPFFKTGKKLRDRLNGAV

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.536 kDa

MIKSELVQIIASRNPHLFQRDVVNIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVDVEEKWVPFFKTGKKLRDRLNGAV

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.567 kDa

MIKSELVQIIASRNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVDVEEKWVPFFKTGKELRDRLNGAV

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.679 kDa

MTKSELIERLCAEQTHLSAKEVEDAVKDILEHMASTLESGDRIEIRGFGSFSLHYREPRVGRNPKTGDKVELEGKYVPHFKPGKELRERVNLGS

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.693 kDa

MTKSELIERLCAEQTHLSAKEIEDAVKDILEHMASTLESGDRIEIRGFGSFSLHYREPRVGRNPKTGDKVELEGKYVPHFKPGKELRERVNSGL

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.67 kDa

MIKSELVQKIAEANPHLYQRDVENIVNAILEQVASALERGDRVELRGFGAFSVKKRDARVGRNPRTGKQVDVSEKTVPYFKTGKEMRERLNTGK

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.567 kDa

MIKSELVQIIASRNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVDVEEKWVPFFKTGKELRDRLNGAV

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.567 kDa

MIKSELVQIIASRNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVDVEEKWVPFFKTGKELRDRLNGAV

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.974 kDa

MIKSELFERIAEQKINISNKMIERAAKEMLEHMIISLANGKRIEIRGFGSFSLHYRSSRIGRNPKTGKSVKLNEKYVPYFKPGKKLRDRANIHK

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.974 kDa

MIKSELFERIAEQKINISNKMIERAAKEMLEHMIISLANGKRIEIRGFGSFSLHYRSSRIGRNPKTGKSVKLNEKYVPYFKPGKKLRDRANIHK

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.974 kDa

MIKSELFERIAEQKINISNKMIERAAKEMLEHMIISLANGKRIEIRGFGSFSLHYRSSRIGRNPKTGKSVKLNEKYVPYFKPGKKLRDRANIHK

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.621 kDa

MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.546 kDa

MTKSELIERLAGQQSHIPAKAVEDAVKEMLEHMAATLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVELDGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.518 kDa

MTKSELIERLAGQQSHVPAKAVEDAVKEMLEHMAATLADGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVELDGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.637 kDa

MTKSELIERLATQQSHIPAKTVEDAVKDMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

Has an essential role in conjugative DNA transfer (CDT), the unidirectional transfer of ssDNA plasmid from a donor to a recipient cell. It is the central mechanism by which antibiotic resistance and virulence factors are propagated in bacterial populations. Part of the relaxosome, which facilitates a site- and strand-specific cut in the origin of transfer by TraI, at the nic site. Relaxosome formation requires binding of IHF and TraY to the oriT region, which then facilitates binding of TraI.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.

10.651 kDa

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

ihfB

Integration host factor subunit beta

94 amino acids

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Belongs to the bacterial histone-like protein family.