Protein
Eukaryotic translation initiation factor 4E-1
Organism
Caenorhabditis elegans
Function
Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. All 5 eIF4E proteins bind monomethyl cap structures. Only ife-1, ife-2 and ife-5 bind trimethyl cap structures which result from trans-splicing. Translation of trimethyl cap structure mRNAs may be regulated by intracellular redox state; disulfide bonds change the width and depth of the cap-binding cavity determining selectivity to mRNA caps. Required for progression through meiotic divisions during spermatogenesis and for the production of viable sperm. It is not required during oogenesis.
Similarity
Belongs to the eukaryotic initiation factor 4E family.
Sequence
MTETEQTTAPIYPLKRNWTWWYLNDERNKSWEDRLKKVYTFNTVSEFWALYDAIRPPSGLNALCDYNVFRDDIQPMWEVPENSNGGRWLIVIDKGKTPEMVDAIWLEILMALVGEQFGKDMESICGLVCNVRGKGSKISVWTKDCNDDETNMRIGVVLKEKLMAASKDHSKPLFDVIRYEDHESCQKKTSSVVKAKLSLHSSDAPVAEKSAV