IER2

Immediate early response gene 2 protein

223 amino acids

DNA-binding protein that seems to act as a transcription factor (PubMed:19584537). Involved in the regulation of neuronal differentiation, acts upon JNK-signaling pathway activation and plays a role in neurite outgrowth in hippocampal cells (By similarity). May mediate with FIBP FGF-signaling in the establishment of laterality in the embryo (By similarity). Promotes cell motility, seems to stimulate tumor metastasis (PubMed:22120713).

Belongs to the IER family.

24.196 kDa

MEVQKEAQRIMTLSVWKMYHSRMQRGGLRLHRSLQLSLVMRSARELYLSAKVEALEPEVSLPAALPSDPRLHPPREAESTAETATPDGEHPFPEPMDTQEAPTAEETSACCAPRPAKVSRKRRSSSLSDGGDAGLVPSKKARLEEKEEEEGASSEVADRLQPPPAQAEGAFPNLARVLQRRFSGLLNCSPAAPPTAPPACEAKPACRPADSMLNVLVRAVVAF

Ier2

Immediate early response gene 2 protein

221 amino acids

DNA-binding protein that seems to act as a transcription factor (By similarity). Involved in the regulation of neuronal differentiation, acts upon JNK-signaling pathway activation and plays a role in neurite outgrowth in hippocampal cells (By similarity). May mediate with FIBP FGF-signaling in the establishment of laterality in the embryo (By similarity). Promotes cell motility, seems to stimulate tumor metastasis (By similarity).

Belongs to the IER family.

24.459 kDa

MEVQKEAQRIMTLSVWKMYHSRMQRGGLRLHRSLQLSLVMRSAREVYLSAKVEAHQPEFPPSRRALDPRLHPPREAEVAVEVASPEAVQPPEPMDTQEEVLRVQETPALCDPPPARVSRKRRSSSDLSDGSDAGLVPSKKARLEEVEGEATSEVPDRLQLPPAQSEGAFPNLARVLQRRFSSLLNCGPAVPPPTPPTCEAKPACRPADNMLNVLVRAVVAF

Ier2

Immediate early response gene 2 protein

221 amino acids

DNA-binding protein that seems to act as a transcription factor (By similarity). Involved in the regulation of neuronal differentiation, acts upon JNK-signaling pathway activation and plays a role in neurite outgrowth in hippocampal cells (PubMed:17156131). May mediate with FIBP FGF-signaling in the establishment of laterality in the embryo (By similarity). Promotes cell motility, seems to stimulate tumor metastasis (By similarity).

Belongs to the IER family.

24.596 kDa

MEVQKEAQRIMTLSVWKMYHSRMQRGGLRLHRSLQLSLVMRSARELYLSAKVETHQPEFPPSRRALDPRLHPPREPEAAMEAATPDVEQPPEPMDTQEEVLRVQETPALCDPPPARVSRKRRSSSDLSDGSDAGLVPSKKARLEEVEGEATSEVSNRLQLPPAQTEGAFPNLARVLQRRFSSLLNCGPAVPPPTPPTCEAKPACRPADNMLNVLVRTVVAF

ier2

Immediate early response gene 2 protein

180 amino acids

DNA-binding protein that seems to act as a transcription factor (By similarity). Mediates with FIBPB FGF-signaling in Kupffer's vesicle ciliogenesis and in the establishment of laterality in the embryo (PubMed:19164561).

Belongs to the IER family.

19.684 kDa

MDVTAEAKQIMVQALGKMYSSRSQRGGLRLHRSLLLTLVMKSARDIYHSARLMSEKSGQSVTEECTSHTQEPMDTSSSTATPLRETSGQSSEDGQRSGLEGHPHPLNPAADKENCGPSRPDRHSRKRRSKTATDSDFIPCKKAKLECAEVRGVLQNSSANCGRALDSLSLVPMPRTIVTF