Function
Transaminase; part of the gene cluster that mediates the de novo generation of L-homotyrosine from acetyl-CoA and 4-hydroxyphenyl-pyruvate (PubMed:22998630). L-homotyrosine is a building block of echinocandin B, a fungal lipidated cyclic hexapeptide that acts as an antifungal agent (PubMed:22998630). L-homotyrosine 4-hydroxyphenyl-pyruvate first undergoes an aldol-type condensation by htyA with the C-2 of acetyl-CoA followed by the release of CoA to form 2-(4-hydroxybenzyl)-malate (PubMed:22998630). This is followed by isomerization of 2-(4-hydroxy-benzyl)-malate to 3-(4-hydroxybenzyl)-malate by htyD (PubMed:22998630). Thereafter, 3-(4-hydroxybenzyl)-malate undergoes decarboxylation and oxidation to form 2-oxo-4-(4-hydroxybenzyl)butanoic acid, coupled to reduction of NAD(+) to NADH by htyC (PubMed:22998630). The product then undergoes transamination catalyzed by htyB to form L-homotyrosine (PubMed:22998630).
Sequence
MIATEYPRPPLAGIDWNHLGFEPVEVNGHIESRFSPSTKTWSTPTFIPDPYIRIHGLTPALNYGQQIFEGLKAFRTPSGSITVFRPDQNAHRFARSARAVSIPPIPTDIFLEAVHLAVGMNSEFVPPVGTGAALYIRPLAFASSATVGLALASEFLFCVYVLPVAPLHKHSGENDKDRKKRGVRALVVEDFDRAAPRGTGDVKVGGNYGPALGRIDAARQEGYGLTLHLDSQSRSLVDEFSTSGFIGVRKENDDELKLVVSDSQQIVASVTIDSICEIARGFGWAVEKRSIAFTEVSEFVEVYAAGTAAMLVPVQSVERRSTGEFIQYSVDYAEPTSVFAQLYKALSGVQQGLVPDQWGWTQEVLRPKQLASQDTEADT