hslU

ATP-dependent protease ATPase subunit HslU

491 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

55.514 kDa

MIQPDEPQDFPVKLIDKEQLTPTQIVEQLDKYIIGQKDAKRSVAIALRNRLRRQNVSEELRDEIMPNNIIMIGPTGVGKTEIARRLAKLAKAPFVKVEASKFTEVGYVGRDVESMIRDLVEQAVAMVRSEKTEEVREKAALLVEERLLDILLPPVSGLEESEHVGDEEEAVVVEGDAEVVVEKNLEREINRKSRQKMRERLRDGRMEDRQIELEVSSDGQGGMMQIFGPLGQMEEIGNIMQDLMSGMPKKRKKRRMTIAEARKYLEQEEVQKLIDMDAVVKEALRKVEDSGIVFIDEIDKIAAPTTGAGGKGPDVSREGVQRDLLPIVEGTAVSTKYGVVKTDHVLFIASGAFHVARPSDLIPELQGRFPIRVELKSLTEEDFFLILTQPRNALIKQYRAMLKTEQIDLEFTEEAIREIARTAAKVNETVENIGARRLHTILTNLLEELMFGIPEMVMDGTIDRNIVIDDNQVREKLGKLVADRDLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

485 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

54.068 kDa

MNEELKDLTPKQTVAELDKYIIGQNKAKRAVAIALRNRMRRLKLPEEIRDEIAPKNILMIGPTGVGKTEIARRLAKLSGAPFLKVEATKYTEVGYVGRDVESMIRDLMAVGYTMVKSEMQEKLKEQAEKNTEESLLDLLLPGSNKKKTAATSAQPQDVSQASSGTTISLPSVSSTAQAEEHKAQNENDMSGTREKFRVMLRENKLEDKMVEVTISPSMGTPTFEFFAGGSNMEDIESAMSNISSMLMGGAKSKRKNVSVKEAREIIMAEQLDRMVDHDKVTDEAKQRVEQMGIIFIDEIDKVASRSDRGGGPDVSREGVQRDILPIVEGSKVSTKYGVVDTRHILFIAAGAFSVSKPSDLIPEFQGRFPLRVELEALHAEDFKRILLEPKNALTKQYAELLETEGVKIEFLDEAIDRMSFLAADVNSKNENIGARRLHTIMEMLLEDISFNASEMGGETVKIDVAYVDERLKDIVQDQDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

483 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.432 kDa

MSNLTPREIVSELDKYIVGQNAAKRMVAVAMRNRWRRQQLDPALRDEIAPKNIIMMGPTGVGKTEIARRLAKLSASPFIKVEATKFTEVGYVGRDVESMVRDLMEIGIALVRAEENEKVRVKAEARAEERLLDLLLPGGAPQPAPAQGMGGLTFDLSASHSGGQAIPQPPAQADASQASPPTGTGSAPDSRSSTREKLRTLWHGGKLDDREVDMEVEESGGPQVGVLSMPGLEDVGSQVRDMFSKVFPSRRKRRRMKVRDAFNLLTQEEADRLIDHDRVSDLARERVEQTGIIFIDEIDKIASGSTQKSSDVSREGVQRDLLPIVEGSVVNTKYGMVRTDHILFIAAGAFHFSKPSDLIPELQGRFPLRAELSALGKDDFLRILTEPHNALTRQYTALLQTEGVHIEFTGDALREIAAFAEETNAQTENIGARRLYTILEKILADLSFEAPDRSGDRVTVDSDYVREHLADVRANKDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

479 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

54.041 kDa

MANHPIDQELTSPAEEELTPREIVAKLDEHIISQKNAKKAVAIALRNRTRRKKLDPEMREEIYPKNIIMIGPTGVGKTEIARRLSKLCGAPFLKVEATKYTEVGYVGRDVESMIRDLAVISMNLVKQEFRTKVEETAKQKAEEALLDILLPFPGENKHGSGQITGFATSSTLADEEDRKTHFLETREFMRKKLKTGKLDDQEVELDLPNPSVSQVPMLQVFGAGNLDDLDNQLQNVLGDILPKKNKKRKLKIPEALKALEESEAEKLLDPDKVQREALRRVEEMGIIFLDEIDKIAGREGKSGADVSREGVQRDLLPIVEGATVNTKIGPVKTDHILFIAAGAFHMTKPSDLIPELQGRFPIRVELEKLSREDFEKILTAPRSSLTRQYEALLSTDGIQLEFSLDGIQEIARIAYDMNEKHENIGARRLNTILERLLEEVSFEGPDLPESQRKVRIDGKYVTDRLQGVIQNKDLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

479 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.988 kDa

MANHPIDQELTSPAEEELTPREIVAKLDEHIISQKNAKKAVAIALRNRTRRKKLDPEMREEIYPKNIIMIGPTGVGKTEIARRLSKLCGAPFLKVEATKYTEVGYVGRDVESMIRDLAVISMNLVKQEFRTKVEETAKQKAEEALLDILLPFPGENKHGSGQITGFATSSTLADEEDRKTHFLETREFMRKKLKTGKLDDQEVELDLPNPSVSQVPMLQVFGAGNLDDLDNQLQNVLGDILPKKNKKRKLKIPEALKALEESEAEKLLDPDKVQREALRRVEEMGIIFLDEIDKIAGREGKSGADVSREGVQRDLLPIVEGATVNTKIGPVKTDHILFIAAGAFHMTKPSDLIPELQGRFPIRVELEKLSREDFEKILTAPCSSLTRQYEALLSTDGIQLEFSLDGIQEIARIAYDMNEKHENIGARRLNTILERLLEEVSFEGPDLPESQRKVRIDGKYVTDRLQGVIQNKDLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

472 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.615 kDa

MEEINKTPKQIVAALDNYVIGQNQAKKAVAIALRNRYRRMELSAEMQEEITPKNMLMIGPTGVGKTEIARRLAKIVHAPFVKVEATKFTEVGYVGRDVESMVRDLVDVAIEMEKQQAYSGVRAQAVQAADKRLVKLLVPAQKKQAKNNGNEFQNMMNMFSQMQNGQTPNVDDSSNEEVTDEVRNQRLSVADQLKTGRLENSEVTIEMDDPQQAAAGNNNMLGQMGIDLGDSLGALMPKKRIQRTMPVSEAREILVREESEKLVNNADIYHDAIVRAENTGIIFIDEIDKITKGGQQGSGEVSREGVQRDILPIVEGSQISTKYGPINTDHILFIASGAFAESKPSDLIAELQGRFPIRVELDDLSKDDFVKILTEPKNALIKQYIALIGTDNIKVTFTIEAIEAIATIAYKVNHETQNIGARRLHTILEKLLEELLYEGPDMEMGEVTITESYVNERIGNIAQDKDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

470 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.876 kDa

METNGIKLTPRDIVSKLNEYIVGQDDAKRKVAIALRNRYRRSLLTEEEKQEVAPKNILMIGPTGVGKTEIARRMARLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVAVRLVKDQKKALVQDEAQDKANEKLVKLLVPSMKKKANNNTNSNNPLESLFGGSIPNFGQNNDDEEETPTDEVKTKRSEIKQQLLNGQLEDEKVRLKVEQDPAAMGMLGTNQNQQMQDMMNQLMPKKKVEREVPVKTARKILTDEFADELIDQETANQEAIELAEQMGIIFIDEIDKVATNNQNSGQDVSRQGVQRDILPILEGSMVQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELESLSVEDFVRILTEPKLSLIKQYEALLQTEQVTVKFTDEAIKRLAEIAFQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

469 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.228 kDa

MTNLTLMNQLTPKQIVEKLDQYIIGQTGAKKSVAVALRNRYRRQLMDESIRDEIIPKNILMIGPTGVGKTEIARRIAKIVRAPFSKVEATKFTEVGYVGRDVESMVRDLVEVSVRLVKEEKMQLVRVKAEKNAEKRLIKLLAPSQKKKQTTSQNPLEALFGSMNQPDEPAEEEVDQELKNKRSQIEWRLQNGELDDEIVTVEVKEQQNPMFDMMRGTGMDQMSGMQDALSGMFPAKKKKRKVTVREAKKILFEDEASKLIDSDELAAEGIHRAEQMGMIFIDEIDKIASKEGGGNAQVSREGVQRDILPIVEGSQISTKYGTVNTEYILFIAAGAFHMSKPSDLIPELQGRFPIRIELDKLTQEDFYKILTEPDNALIKQYKALLKTEGIDLIFTKEAVERIAEIAFQVNQDSDNIGARRLHTILEKLLEDLLFEAPEINMESIKVTENYVNEKLAPIMTNKDLTQFIL

hslU

ATP-dependent protease ATPase subunit HslU

469 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.188 kDa

MTNITLMNQLTPKQIVEKLDQYIIGQTGAKKSVAVALRNRYRRQLMDESIRDEIIPKNILMIGPTGVGKTEIARRIAKIVRAPFSKVEATKFTEVGYVGRDVESMVRDLVEVSVRLVKEEKMQLVRVKAEKNAEKRLIKLLAPSQKKKQTTSQNPLEALFGGMNQPDESPEEEVDQELKNKRSQIEWRLQNGELDDEIVTVEVKEQQNPMLDMMRGAGMDQMNGMQDALSGMFPAKKKKRKVTVREAKKILFEDEASKLIDADELAAEGIHRAEQMGMIFIDEIDKIASKEGGGNAQVSREGVQRDILPIVEGSQISTKYGTVNTEYILFIAAGAFHMSKPSDLIPELQGRFPIRIELDKLTQEDFYKILTEPDNALIKQYKALLKTEGIDLIFTKEAVERIAEIAFQVNQDSDNIGARRLHTILEKLLEDLLFEAPEINMESIKVTENYVNEKLAPIMQNKDLTQFIL

hslU

ATP-dependent protease ATPase subunit HslU

469 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.188 kDa

MTNITLMNQLTPKQIVEKLDQYIIGQTGAKKSVAVALRNRYRRQLMDESIRDEIIPKNILMIGPTGVGKTEIARRIAKIVRAPFSKVEATKFTEVGYVGRDVESMVRDLVEVSVRLVKEEKMQLVRVKAEKNAEKRLIKLLAPSQKKKQTTSQNPLEALFGGMNQPDESPEEEVDQELKNKRSQIEWRLQNGELDDEIVTVEVKEQQNPMLDMMRGAGMDQMNGMQDALSGMFPAKKKKRKVTVREAKKILFEDEASKLIDADELAAEGIHRAEQMGMIFIDEIDKIASKEGGGNAQVSREGVQRDILPIVEGSQISTKYGTVNTEYILFIAAGAFHMSKPSDLIPELQGRFPIRIELDKLTQEDFYKILTEPDNALIKQYKALLKTEGIDLIFTKEAVERIAEIAFQVNQDSDNIGARRLHTILEKLLEDLLFEAPEINMESIKVTENYVNEKLAPIMQNKDLTQFIL

hslU

ATP-dependent protease ATPase subunit HslU

469 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.162 kDa

MTNLTLMNQLTPKQIVEKLDQYIIGQTGAKKSVAVALRNRYRRQLMDESIRDEIIPKNILMIGPTGVGKTEIARRIAKIVRAPFSKVEATKFTEVGYVGRDVESMVRDLVEVSVRLVKEEKMQLVRVKAEKNAEKRLIKLLAPSQKKKQTTSQNPLEALFGGMNQPDESAEEEVDQELKNKRSQIEWRLQNGELDDEIVTVEVKEQQNPMLDMMRGAGMDQMNGMQDALSGMFPAKKKKRKVTVREAKKILFEDEASKLIDADELAAEGIHRAEQMGMIFIDEIDKIASKEGGGNAQVSREGVQRDILPIVEGSQISTKYGTVNTEYILFIAAGAFHMSKPSDLIPELQGRFPIRIELDKLTQEDFYKILTEPDNALIKQYKALLKTEGIDLIFTKEAVERIAEIAFQVNQDSDNIGARRLHTILEKLLEDLLFEAPEINMESIKVTENYVNEKLAPIMQNKDLTQFIL

hslU

ATP-dependent protease ATPase subunit HslU

469 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.226 kDa

MTNLTLRNQLTPKQIVEKLDQYIIGQNGAKKSVAVALRNRYRRQLMDESIRDEIIPKNILMIGPTGVGKTEIARRIAKIVRAPFSKVEATKFTEVGYVGRDVESMVRDLVEVSVRLVKEEKMQLVRVKAEKNAEKRLIKLLAPSQKKKQTTSQNPLEALFGGMNQPDESPEEEVDQELKNKRSQIEWRLQNGELDDEIVTVEVKEQQNPMLDMMRGAGMDQMNGMQDALSGMFPAKKKKRKVTVREAKKILFEDEASKLIDADELAAEGIHRAEQMGMIFIDEIDKIASKEGGGNAQVSREGVQRDILPIVEGSQISTKYGTVNTEYILFIAAGAFHMSKPSDLIPELQGRFPIRIELDKLTQEDFYKILTEPDNALIKQYKALLKTEGIDLIFTKEAVERIAEIAFQVNQDSDNIGARRLHTILEKLLEDLLFEAPEINMESIKVTENYVNEKLAPIMQNKDLTQFIL

hslU

ATP-dependent protease ATPase subunit HslU

469 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.225 kDa

MTNLTLMNQLTPKQIVEKLDQYIIGQTGAKKSVAVALRNRYRRQLMDESIRDEIIPKNILMIGPTGVGKTEIARRIAKIVRAPFSKVEATKFTEVGYVGRDVESMVRDLVEVSVRLVKEEKMQLVRVKAEKNAEKRLIKLLAPSQKKKQTTTQNPIEALFGGMNQSEETTEEEVDQELKNKRSQIEWRLQNGELDDEIVTVEVKEQQNPMLDMMRGAGMDQMNGMQDALSGMFPAKKKKRKVTVREAKKILFEDEASKLIDADELAAEGIHRAEQMGMIFIDEIDKIASKEGGGNAQVSREGVQRDILPIVEGSQISTKYGTVNTEYILFIAAGAFHMSKPSDLIPELQGRFPIRIELDKLTQEDFYKILTEPDNALIKQYKALLKTEGIDLIFTKEAVERIAEIAFQVNQDSDNIGARRLHTILEKLLEDLLFEAPEINMESIKVTENYVNEKLAPIMKNKDLTQFIL

hslU

ATP-dependent protease ATPase subunit HslU

469 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.567 kDa

MNKIDELTPKKVVEKLDNYIIGQKEAKKQVAIALRNRIRRLSLSEDVRKDVIPKNILMIGSTGVGKTEIARRLAEVANAPFVKVEATRFTEVGYVGKNVESMVRELVDSSVNMVKKEMMEEVKDKAQRLVEERIVEVLVPSKKRAKAQPSFMDVMQLFNQNAEYSQNKDYDENEDENIRRRREELLEKLRNGELEDVEIEVEVEEQSSPMFAGLGPELEDMGIQFGEMFQNLMPKKKKRRRMKISEARKVLEPIESEKLIDQDKLIQEGVSRAENSGIIFIDEIDKITSKGVSSGPDVSREGVQRDLLPIVEGTTVMTKYGSISTDYILFIAAGAFSEAKPSDLIPELQGRFPIRAELSDLTKEDFIRILTQPKNAILKQYQYLLQTDGVKIEFTEDGVERMADIAFELNEKVENIGARRLYTVVEKVLEEVSFEAPASGEWELKIDSNYVDLRLGKVYGDEDLREYIL

hslU

ATP-dependent protease ATPase subunit HslU

468 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.362 kDa

MDASAIKLTPKDIVSQLNEYIVGQNDAKKKVAIALRNRYRRSQLDEEMKQEIVPKNILMIGPTGVGKTEIARRMAKIVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVAVRLVKEDRKDKVKDEAVKKANDKLVKLLVPSMKKKANQNAGNPFESIFGGMMPNFGNNDEEDEEPPTEDIKTKRSEIRSQLLNGQLEEEKVRIKVEQDPGALGMLGTNQNQQVQDMMNQLMPKKKVEREVPVKTARKILADEYADELIDHETANQEALELAEQMGIIFIDEIDKVASNNQGGGQDVSRQGVQRDILPIVEGSVVQTKYGSVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLSVDDFVNILKEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSYEAPGMPNAVVDITAQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.824 kDa

MAIKTPKEIVKILNEYIIGQDEAKKSVAIALYNRYRRMQLSKQMQHEITPKNLLMAGPTGVGKTEIARRLASIVEAPFVKVEATKFTEVGYVGRDVESMVRDLVGEAVRMEEKDQFARVKPQATKEANKQLVRLLAPGVKREKRENQMQQMQDMMSMLMGGANPNNQNNDQEEVTDEVRNERMDVAEKLNKGLLEDREVTIEVEQAPKANPMSDMMGQMGMDMGSMLNDIMPKKKVKRTLSVRDAREVLIQEESRKMVDYDTIYQRAIERSQNNGIIFIDEIDKIIAGNKRNSGEVSREGVQRDVLPIVEGSTVNTKYGPVSTDHILFIAAGAFAESKPSDLIPELQGRFPIRVELNALTKDDFVKILKDPQNSLLKQYIALMKADGIKLIFTQEAVDKIAQIAFDVNQGTDNIGARRLSTILEKLLEDVLYEGPDMEMGEITITEAYVEEKLHDIIMNKDLTKFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.373 kDa

MNEIDKTPRQIVAELDKYVIGQDSAKRAIAVALRNRYRRIQLPKDMQEDISPKNLLMIGPTGVGKTEIARRLAKIVNAPFVKVEATKFTEVGYVGRDVESMARDLVEVAYRMEQNDAFKQVRAQAAQQANKRLVKLIVPAKKKQENPNQYLFNALRDLQSGSFPNMNGNDMEEVTEDVRNERLSVAEQLKRGLLENNEVTIQVDDPSTQFNNQSGMLGQMGIDLSSLSSMMPTKKVERTMTVAEAREILIKEESEKLVNSADLADAAIKRAENTGIIFIDEIDKIASKSQQNAGQVSREGVQRDILPIVEGSQISTKYGLVKTDHILFIGSGAFHESKPSDLIAELQGRFPIRVELEDLSVDDFVKILTEPNNALVKQYIAMIGTDNIDVTFTIEAIHRIAEVAYQLNHDTENIGARRLHTILEKLLEDLLFEGPDMQMGDIKITEAYVNDKIGSIVEDKDLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.329 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTELGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.315 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.315 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.315 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.315 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.315 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPLRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.315 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.315 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.329 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTELGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.329 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTELGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.299 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLAVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.315 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.315 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.315 kDa

MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKKSLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.454 kDa

MDTNGIKLTPKDIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLKEEEKQEIAPKNILMIGPTGVGKTEIARRMAKIVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVAVRLVKDEKKSLVKDEATKKANDKLVKLLVPSLKKKAAQGNNPLENLFGGAIPNFGQNQDEEEEPPTEEIKTKRSEIKKQLEQGKLENEKVRIKVEQDPASMGMLGTNQNQQIQDMMNQLMPKKKVEREVSVETARKILADDFADELIDQETANQQALELAEQMGIIFIDEIDKVATNNQNSGQDVSRQGVQRDILPILEGSMIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELESLSVEDFVRILTEPKLSLVKQYEALLQTEEVTVNFSEDAIQRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.454 kDa

MDTNGIKLTPKDIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLKEEEKQEIAPKNILMIGPTGVGKTEIARRMAKIVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVAVRLVKDEKKSLVKDEATKKANDKLVKLLVPSLKKKAAQGNNPLENLFGGAIPNFGQNQDEEEEPPTEEIKTKRSEIKKQLEQGKLENEKVRIKVEQDPASMGMLGTNQNQQIQDMMNQLMPKKKVEREVSVETARKILADDFADELIDQETANQQALELAEQMGIIFIDEIDKVATNNQNSGQDVSRQGVQRDILPILEGSMIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELESLSVEDFVRILTEPKLSLVKQYEALLQTEEVTVNFSEDAIQRLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.337 kDa

MDANGIKLTPKDIVSKLDEYIVGQDDAKRKVAIALRNRYRRSLLDEETKQEIAPKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVAVRLVKDQKKGLVKDEAVNKANEKLVKLLVPSMKKKASNNSNPLESLLGGAIPNFGNNDDEEEETPTEEIKTKRSEIKKQLLDGKLEEEKVRIKVEQDPGALGMLGTNQNQQMQDMMNQLMPKRKVEREVPVKTARKILADDFADELIDQETANQEALELAEQMGIIFIDEIDKVATNNANSGQDVSRQGVQRDILPILEGSMIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELESLTVDDFYRILTEPKLSLIKQYEALLQTEEVTVNFTKEAITRLAEMAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL

hslU

ATP-dependent protease ATPase subunit HslU

467 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.835 kDa

MNELNKTPKEIVKELDQYIVGQQAAKKSVAVALRNRYRRLQLEENMQQDITPKNLLMIGPTGVGKTEIARRLAKIVNAPFVKVEATKFTEVGYVGRDVESMVRDLVENAIQIVEKQQYSRVYAQALKKANQRLVKVLVPGIKKEQKQAGGNQFEQMMNMFNMAQQQQEAQEEVTEDIRTNRRTILEQLEKGLLDNREVTIEIEEPKKTMPAMNNGLEQMGIDLNETLGALSPKKKIERTVTVKEAQELLVKEESAKIVNDADIHSEAIRLAESSGIIFIDEIDKITSKSQQNSGEVSREGVQRDILPIVEGSQVNTKYGPLQTDHILFIASGAFHLSKPSDLIPELQGRFPIRVELDDLTADDFVSILTEPNNALIKQYVALIGTENVSVIFTKEAIERLAHIAYDVNRDTDNIGARRLHTILERLLEDLLYEAPDMQMGEITITEAYVNEKLNDIVQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

466 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.809 kDa

MAIKTPKEIVKILNEYIIGQDEAKKSVAIALYNRYRRMQLPKQMQREITPKNLLMAGPTGVGKTEIARRLATIVEAPFVKVEATKFTEVGYVGRDVESMVRDLVGEAVRMEEKDQFARVKPQATKEANKELVRLLAPGEKREKRENQVQQMQDMMSMLMGGMNNQTNNNQEEISEEVRNQRMDVAEKLNKDLLEDREVTIEVEQAPKANPMSDMMGQMGMDMGSMLNDIMPKKKVKRTLPVREAREVLIQEESRKLVDYDTIYQRAIERSQNNGIIFIDEIDKIIAGNKRNSGEVSREGVQRDILPIVEGSTVNTKYGPVSTDHILFIAAGAFAESKPSDLIPELQGRFPIRVELNALTKDDFVKILKDPQNSLLKQYIALLKADGIKLIFTQEAVDKIAEIAFDVNQGTDNIGARRLSTILEKLLEDVLYEGPDMEMGEITITEAYVEEKLGDIIMNKDLTKFIL

hslU

ATP-dependent protease ATPase subunit HslU

466 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.704 kDa

MFKLTPREIVEELDKYIIGQQEAKKAVAIALRNRYRRKLLPDELREEIYPKNIIMIGSTGVGKTEIARRLARLVKAPFIKVEASKFTEVGYVGRDVDSMVRDLVETSIRLVKQEKMAAVEQKGRQMAEERIVDILLPFDGRKSKSPKNPFEFLLGSIQERDDVDDESERRRREIGQRREILRQKINRLELEDETIEIEVEEKNPSFMEIFSGSGVEEMGINLQDMLGNLMPRNKKKRKVSIAEARRILTYEESQRLLDMDEIHREGIKRAEEDGIIFLDEIDKIASKESNYGPDVSRGGVQRDILPIVEGSTVITKYGPARTDHVLFIAAGAFHVSKPSDLIPELQGRFPIRVELESLKKEDLKRILTEPNNSLIKQYIALLSTEKLTMDFTPEAIDYIAERAYEVNSRTEDIGARRLHTVMEKLLEDLLFNSPDMAGEKLVIDIDYVAERLDRIVEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

466 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.18 kDa

MEALTPRQTVRELDKYIVGQEKAKKAVAVALRNRYRRSKLKEDLIDEVVPKNILMIGPTGVGKTEIARRLAKLVKAPFVKIEATKFTEVGYVGRDVESMVRDLVETSIRMLKQEKVEEVEERAKRLADERIIELLAPYPNRPTQTKNPFEMLFGGVQDTQQEDKSWEQQNSRIKFERETLREKMSRCELEKDYLEIEVEDQSTPMLEVFSNSGVEEMGVNMQDVLGSIFPRKKRKRKVTVEEARKILTQQEAQKLIDMDELTAQAVKRAEDHGIIFLDEIDKIATREGTTGSADVSRGGVQRDILPIVEGSTVMTKYGPVKTDHILFIAAGAFHIAKPSDLIPELQGRFPIRVELESLSRSDFEQILTEPQNSLIKQYTELLGTEGLKIEFSKNSLVEIADIAYTVNEQNENIGARRLHTILEKLLEDVSFEAPELNGQSLTIDSDYVREKLKDVVTNRDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

465 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.972 kDa

MNELTPQEIVRELDKYIVGQERAKRCVAIALRNRYRRAKLPKELQDEITPKNILMVGPTGVGKTEIARRLAKLVNAPFVKVEATKFTEVGYVGRDVDSMVRDLVENAISLVKSEYMEKMKERAKALVEDRILEILIPEPHARKAGFKNPFEALFGAPSQEPEQTYQTTDDYIRTQREILREKLRSGELEDKVIEVEVEDTVKPPFEMIMGTISDEMGISFQDVFGSLFPKKKKKKKMTIREAREVLEQEEYNKLIDMDEVIKEAIHRAEQHGIIFIDEIDKIAGRGSGVGPDVSREGVQRDILPIVEGSTVMTKYGPVKTDHILFIAAGAFHVAKVSDLIPELQGRFPVVVELHPLTEEDFKKILTQPKNAITKQYIELMKTEGVNITFTDDAIEAIAKVAVKINEQSENIGARRLHTVVEKIMEDISFEYANVEKPIDVVIDKDYVYSKVSDMIKDKDLNRFII

hslU

ATP-dependent protease ATPase subunit HslU

465 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.349 kDa

MMAETLTPRQIVEKLDQFIVGQKEAKKAVAIALRNRYRRSLLDEKLRDEVMPKNILMIGPTGVGKTEIARRLAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRLVKERKMNEVKDRAEQQANKRLVELLVPGKPKQTIKNPLELLFGGQGAQADNSYSHEDEQVEQKRRQVAWQLANGQLENEMVTIEIEEQTPLWFDFLQGAGIEQMGMNMQDALSSLMPKRRKKRRLKVSEARKVLINEEAQKLIDMDEVTQEAVRLAEQSGIIFIDEIDKIARSGAVSGSADVSREGVQRDILPIVEGSTVMTKYGPVKTDHILFIAAGAFHMAKPSDLIPELQGRFPIRVELAKLSVDDFVRILVEPNNALIKQYQALLATEGISLEFSDDAIRKIAEVAFEVNQTTDNIGARRLHTILEKLLEDLLFEAPDIGIDKVVITPQYVEQKLGSIVKNKDLSEFIL

hslU

ATP-dependent protease ATPase subunit HslU

465 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.653 kDa

MSEALTPRQIVEKLDQFIVGQKEAKKAVAIALRNRYRRSLLDEKLRDEVVPKNILMIGPTGVGKTEIARRLAKLVGAPFVKVEATKFTEVGYVGRDVESMVRDLVETSVRLVKERKMNEVKDRAEQQANKRLVELLVPGKQKQTMKNPLELLFGGAQTSQQDTYQTYEDDHIEQKRRQVAWQLANGQLEDEMVTIEVEEQQPMFFDFLQGAGIEQMGMNMQDALSSLIPKRRKKRKLKVREARKVLTNEEAQKLIDMDEVTQEAIRLAEQSGIIFIDEIDKIARSGQAASSADVSREGVQRDILPIVEGSTVMTKYGPVKTDHILFIAAGAFHMAKPSDLIPELQGRFPIRVELTKLSVDDFVKILVEPDNALIKQYKALLATEGINLEFSDDAIRKIAEVAFEVNQTTDNIGARRLHTIMEKLLEDLLFEAPDITLDEVVITPQYVEQKLGNIVKNKDLSEFIL

hslU

ATP-dependent protease ATPase subunit HslU

465 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.455 kDa

MGMDYTPRQIVEQLDQFIVGQKQAKKSVAVALRNRYRRMKLDEGFRDEIVPKNILMIGPTGVGKTEIARRLAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVEMAVRMVKEEKMAGVMNEAEEEANKRLVKLLVPESKKKPAMKNPFEMLFQSDGSDGDDETTEQDSHDEIRSKRKRIAHQLALGELEDHIVSVEIDEVPPSMFDMLQGSGMEQMGMNMQDAFGQFMPKKKKKRNLPVSEARKVLTQQEAQKLVDMDEVAQEATSRAEGSGIIFIDEIDKVAGKQENAANVSREGVQRDILPIVEGSTVVTKHGTVKTDHMLFVAAGAFHMSKPSDLIPELQGRFPIRVELEKLTVEDFKRILTEPSNALIKQYQLMLQTEGINVEFTDEAIERLAEIAYQVNQNTDNIGARRLHTILEKLLEDLSYEAPEITMEKVEITVGYVDDKLSSIVQDKDLSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

465 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.912 kDa

MEELTPRRIVEELDKYIVGQKNAKKAVAIALRNRYRRKKLPEDFKDEVMPKNILMIGPTGVGKTEIARRLARLVKAPFVKVEATKFTEVGYVGRDVEGMVRDLVETSIRMVKQEKMAMVEDRAQKMAEEKIIELLAPYPVQQTAARNPLELLFGAARQAEQTDKNQEQRIKRIDFEREMLREKLARGELENEYLEIEVEDSKPPMLEIFTASGGMEEMGVNLQDMLGGLFPKKKHKRRVTVREARKILTQQEAQKLIDMDEVTAAAIKRAEEDGIIFLDEIDKIAGREGYGPDVSRGGVQRDILPIVEGSTVMTKYGPVKTDHILFIAAGAFHISKPSDLIPELQGRFPIRVELESLTCEDFQQILTEPRNALIKQYTELLATEGVKVKFTENSLVEIAKIAYTVNEQTENIGARRLHTILEKLLEDISFEAPELTGKEIVIDREIVLEKLGELAKNKDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

464 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.938 kDa

MREKTPKQIVDLLDKYIVGQNEAKKSVAIALYNRYRRTQLPEDVQKDITPKNILMAGPTGVGKTEIARRLADIVDAPFVKVEATKFTEVGYVGRDVESMVRDLANEAVRIVEKEEFVKVESQAIRQANKTLVRLLVPGVKRNNRQNQMQQMQEMMQSLLAGGGMPEETEEVTDEIRNQRLSVAEKLDRGLLENEEVTIEVEQAPKANPMGDMMGQMGMDMSSMLGDMLPKKKVKRTLPVGQARKLLVQEEEKKLVNYDDIYQKAMDRAGQSGIIFIDEIDKITAADKRNSAGVSREGVQRDILPIVEGSTVSTKYGPLSTDHILFIAAGAFAESKPSDLIPELQGRFPIRVELNALTKDDFVRILKDPQNSLLKQYIALLKADGVDLVFTAEAVDKIAEIAFEVNQGTDNIGARRLATILEKLLEEVLYEGPDMEMGQITITQAYVEQKLSDIVKNKDLTKFIL

hslU

ATP-dependent protease ATPase subunit HslU

464 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.92 kDa

MREKTPKQIVDLLDKYIVGQNEAKKSVAIALYNRYRRAQLPEDVQKDITPKNILMAGPTGVGKTEIARRLADIVDAPFVKVEATKFTEVGYVGRDVESMVRDLANEAVRIVEKEEFVKVESQAIRQANKTLVRLLVPGVKRNNRQNQMQQMQEMMQSLLAGGGMPEETEEVTDEIRNQRLSVAEKLDRGLLENEEVIIEVEQAPKANPMGDMMGQMGMDMSSMLGDMLPKKKVKRTLPVGQARKLLVQEEEKKLVNYDDIYQKAMDRAGQSGIIFIDEIDKITAADKRNSAGVSREGVQRDILPIVEGSTVSTKYGPLSTDHILFIAAGAFAESKPSDLIPELQGRFPIRVELNALTKDDFVRILKDPQNSLLKQYIALLKADGVDLVFTAEAVDKIAEIAFEVNQGTDNIGARRLATILEKLLEEVLYEGPDMEMGQITITQAYVEQKLSDIVKNKDLTKFIL

hslU

ATP-dependent protease ATPase subunit HslU

464 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.481 kDa

MTEEKTPKQIVELLDKYIIGQNEAKKSVAVALYNRYRRLQLPKQMQQDITPKNMLMAGPTGVGKTEIARRLAKIVDAPFVKVEATKFTEVGYVGRDVESMVRDLVEEAVRMEEKEQFDRVKLQATKKANNRLVKLIVPGIKRENRENSMQQMMQMLSGNFNMNQAQDNEEVTDDIRNERLSVADQLNKGLLENREVTIEVEQAPKVNPMGDMMGQMGIDMSSLMGDLMPKKTVKRTLKVSDAREVLIQEESKKLINYDSLYQRAIERTQQNGIIFIDEIDKITAGNKKTSGEVSREGVQRDILPIVEGSTVSTKYGPVSTDHILFIAAGAFAESKPSDLIPELQGRFPIRVELNALTQEDFVKILKDPQNSLLKQYIALLKADGIKLVFTQEAIDRIAQIAFEVNQGTDNIGARRLATILEKLLEDVLYEGPDMNMGEITITQKYVDQKLSDIIINKDLTKFIL

hslU

ATP-dependent protease ATPase subunit HslU

464 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.462 kDa

MTEEKTPKQIVELLDKYIIGQNEAKKSVAVALYNRYRRLQLPKQMQQDITPKNMLMAGPTGVGKTEIARRLAKIVDAPFVKVEATKFTEVGYVGRDVESMVRDLVEEAVRMEEKDQFEHVKMQATKKANNRLVKLIVPGIKRENRENSMQQMMQMLSGNFNMNQPQDNEEVTDAIRNERLSVADQLNKGLLENREVTIEVEQAPKVNPMGDMMGQMGIDMSSLMGDLMPKKTVKRTLKVSDAREVLIQEESKKLINYDSLYQRAIERTQQNGIIFIDEIDKITAGNKKTSGEVSREGVQRDILPIVEGSTVSTKYGPVSTDHILFIAAGAFAESKPSDLIPELQGRFPIRVELNALTQEDFVKILKDPQNSLLKQYIALLKADGIKLVFTQEAIDRIAQIAFEVNQGTDNIGARRLATILEKLLEDVLYEGPDMNMGEITITQKYVDQKLSDIIINKDLTKFIL

hslU

ATP-dependent protease ATPase subunit HslU

464 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.881 kDa

MREKTPKQIVDLLDKYIVGQNEAKKSVAIALYNRYRRAQLPEDVQKDITPKNILMAGPTGVGKTEIARRLADIVDAPFVKVEATKFTEVGYVGRDVESMVRDLANEAVRIVEKEEFVKVEGQAIRQANKTLVRLLVPGVKRNNRQNQMQQMQEMIQSLLAGGGMSEETEEVTDEIRNQRLSVAEKLDRGLLENEEVTIEVEQAPKANPMGDMMGQMGMDMSSMLGDMLPKKKVKRTLPVSQARKLLVQEEEKKLVNYDDIYQKAMDRAGQSGIIFIDEIDKITAADKRNSAGVSREGVQRDILPIVEGSTVSTKYGPLSTDHILFIAAGAFAESKPSDLIPELQGRFPIRVELDALTKDDFVRILKDPQNSLLKQYIALLKADGVDLVFTAEAVDKIAEIAFEVNQGTDNIGARRLATILEKLLEEVLYEGPDMEMGQITITQAYVEQKLSDIVKNKDLTKFIL

hslU

ATP-dependent protease ATPase subunit HslU

464 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.064 kDa

MTALQGFLTPTEIVAELDKYIIGQHDAKRNVAIALRNRWRRMHADADMRKEIMPNNILLIGPTGVGKTEIARRLAKLADAPFTKVEASKFTEVGYVGRDVESMVRDLVEQAVNMVKTQKKEEVKIKVSQVVEDILLDLLIPPVKSTGMGFKTASTQSIDTNEIPDNDQELNERTRELFREKIRSGELDERKVEINVQQQGPGVGVVGGAMDEASMMNIQEMIGNMMPKKTKKRKLSIAEARKILLEEESAKLIDMDDVKDEAIRKTENMGIIFIDEIDKVASSKKGNGPDVSREGVQRDLLPIVEGSAVNTKYGTVHTDHILFIAAGAFHVSKPSDLIPELQGRFPIRVELNSLTEADFYHILKEPKNALTRQYQALLSSENVNIEFHDDALKAISEIAFELNVEVENIGARRLHTVMSHLLNELLFDVPDKIETHSTVVITKELVDQKLKGLVKNRDLSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

464 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.254 kDa

MAETLTPRQIVERLDQFIIGQKEAKKAVAIALRNRYRRSLLDEKLRDEVMPKNILMIGPTGVGKTEIARRLAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRLVKERKMSEVKDRAEQQANKRLVELLVPGKQKQTIKNPLELLFGGQASQPDNGHSHDDEQVEKKRRQVAWQLANGQLEDEMVTIEIEEQPPMLFDFLQGAGIEQMGVNMQDALGSLMPKRRKKRRLKVSEARKVLINEEAQKLIDMDEVTQEAIRLAEQSGIIFIDEIDKIARGKEVSGSADVSREGVQRDILPIVEGSTVMTKYGPVKTDHILFIAAGAFHMAKPSDLIPELQGRFPIRVELAKLSVDDFVSILVEPNNALIKQYQALLATEGINLEFSDDAIRKIAEVAFEVNQTTDNIGARRLHTILEKLLEDLLFEAPDIGLNRVVITPQYVEQKLGNIVKNKDLSEFIL

hslU

ATP-dependent protease ATPase subunit HslU

464 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.634 kDa

MKNVLTPRQIVERLDQYIVGQEGAKRSVAIALRNRYRRFQLEDKLRDEITPKNILMIGPTGVGKTEIARRLAKLVGAPFVKVEATKFTEVGYVGRDVESMIRDLVETSVRLVKEEKMKGVKKQAEEQANQRIVELLVPAKKKTQAYKNPLEMLFGQQQENTDHQETSAEQDTLTERRRRMSHQLALGELEDHYVTVEVEEQTPQFFDMLQGSGMEQMGMNMQEMLGNMMPKKRKKRKLTVREARRVLTEEEAQKLIDMDEVTQEAVSKAEQLGIVFIDEIDKIAGKGQQSADVSREGVQRDILPIVEGSTVVTKYGPVSTDHMLFIGAGAFHVAKPSDLIPELQGRFPIRVELSNLTVDDFVRILVEPDNALLKQYAALLETEGIKIVFTDEAVHKIATIATEVNQETENIGARRLHTLLERLLEDLSFEAPDVNLEEIVITPEYVTEKLAAIAKNRDLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.213 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLAENLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMVVKVQDKAEEQANQRLVEILVPSPEKQSGFKNPLEMLFGGTQNSNQTTDSQEDVEIEKKRQDVERKLAAGLLEDEIVSIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSFMPKKTKKRKLSVKEARKVLTNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGSNVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSTDDFVKILIEPDNALIKQYMALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTIMEKLLEDLSFEASEITLEKITITPQYVEEKLATIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.213 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLAENLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMVVKVQDKAEEQANQRLVEILVPSPEKQSGFKNPLEMLFGGTQNSNQTTDSQEDVEIEKKRQDVERKLAAGLLEDEIVSIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSFMPKKTKKRKLSVKEARKVLTNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGSNVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSTDDFVKILIEPDNALIKQYMALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTIMEKLLEDLSFEASEITLEKITITPQYVEEKLATIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.213 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLAENLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMVVKVQDKAEEQANQRLVEILVPSPEKQSGFKNPLEMLFGGTQNSNQTTDSQEDVEIEKKRQDVERKLAAGLLEDEIVSIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSFMPKKTKKRKLSVKEARKVLTNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGSNVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSTDDFVKILIEPDNALIKQYMALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTIMEKLLEDLSFEASEITLEKITITPQYVEEKLATIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.213 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLAENLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMVVKVQDKAEEQANQRLVEILVPSPEKQSGFKNPLEMLFGGTQNSNQTTDSQEDVEIEKKRQDVERKLAAGLLEDEIVSIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSFMPKKTKKRKLSVKEARKVLTNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGSNVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSTDDFVKILIEPDNALIKQYMALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTIMEKLLEDLSFEASEITLEKITITPQYVEEKLATIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.052 kDa

MKSFDEMTPKEIVQELDKYIVGQYEAKKAVAIAVRNRIRRQKLPEEWRKEVLPKNILMIGPTGVGKTEIARRLAQLSGSPFLKVEATRFTEVGYVGKNVDSMIRDLVEISVNMVKQEKIKEVERQAEELVEERILDALVPESKAMPVVTNPFINLITGGQQQQYTPEDRRRFRAKREEMREKLRKGELEDEEIEIELEETVSPFMGIFGPGMEDLGIEITNMFSGMLPKRKKKRKMKVSEARKVLLPLEAEKLIDMDKVVQEALDRAQNRGIIFIDEIDKIAGKESAVGPDVSRQGVQRDLLPIVEGTTIMTKYGPVRTDFILFIAAGAFHVSRPSDLIPELQGRFPIRVELSPLTEEDFVRILKEPENAIIKQYQALLSTEGVELVFTEDGIREMARIAYQLNQRLENIGARRLYTVAEKVLEEISFEAPDIPEKRVVVDAEYVRRRLEKIVQDEDLSAYIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.04 kDa

MKSFDEMTPKEIVRELDKYIVGQTEAKKAVAIAVRNRIRRQKLPEEWRKEVLPKNILMIGPTGVGKTEIARRLAQLSGSPFLKVEATRFTEVGYVGKNVDSMIRDLVEISVNMVKQEKMKEVEERAKELVEERILDALVPESRAVPAITNPFINLITGGQQQQYTPEDRRRFRAKREEMRERLRRGELEDEEIEVEIEETASPFMGIFGPGMEDLGIEISNMFSGMLPKRKKKRKMKVSEARKVLLPMEAEKLIDMDKVIQEALDRAQNRGIIFIDEIDKIAGKESASGPDVSRQGVQRDLLPIVEGTTIMTKYGPVRTDYILFIAAGAFHVSRPSDLIPELQGRFPIRVELSPLTEEDFVRILKEPENAIIKQYQALLSTEGVELVFTEDGIREMARIAYQLNQRLENIGARRLYTVAEKVLEEISFEAPDIPEKKVVIDAEYVRKRLERIVQDEDLSAYIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.007 kDa

MKSFDEMTPKEIVQELDKYIVGQYEAKKAVAIAVRNRIRRQKLPEEWRKEVLPKNILMIGPTGVGKTEIARRLAQLSGSPFLKVEATRFTEVGYVGKNVDSMIRDLVEISVNMVKQEKIKEVERQAEELVEERILDALVPESKAVPVVTNPFINLITGGQQQQYTPEDRRRFRAKREEMREKLRKGELENEEIEIELEETVSPFMGIFGPGMEDLGIEITNMFSGMLPKQKKKRKMKVSEARKVLLPLEAEKLIDMDKVVQEALDRAQNRGIIFIDEIDKIAGKESAVGPDVSRQGVQRDLLPIVEGTTIMTKYGPVRTDYILFIAAGAFHVSRPSDLIPELQGRFPIRVELSPLTEEDFVRILKEPENAIIKQYQALLSTEGVELVFTEDGIREMARIAYQLNQRLENIGARRLYTVAEKVLEEISFEAPDIPEKRVVVDAEYVRRRLEKIVQDEDLSAYIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

53.049 kDa

MKSFDEMTPKEIVQELDKYIVGQYEAKKAVAIAVRNRIRRQKLPEEWRKEVLPKNILMIGPTGVGKTEIARRLAQLSGSPFLKVEATRFTEVGYVGKNVDSMIRDLVEISVNMVKQEKIKEVERQAEELVEERILDALVPESKAVPVVTNPFINLITGGQQQQYTPEDRRRFRAKREEMREKLRKGELENEEIEIELEETVSPFMGIFGPGMEDLGIEITNMFSGMLPKQKKKRKMKVSEARKVLLPLEAEKLIDMDKVVQEALDRAQNRGIIFIDEIDKIAGKESAVGPDVSRQGVQRDLLPIVEGTTIMTKYGPVRTDYILFIAAGAFHVSRPSDLIPELQGRFPIRVELSPLTEEDFVRILKEPENAIIKQYQALLSTEGVELVFTEDGIREMARIAYQLNQRLENIGARRLYTVAEKVLEEISFEAPDIPEKRIVVDAEYVRRRLERIVQDEDLSAYIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.114 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLAENLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMVVKVQDKAEEQANQRLVEILVPSPEKQSGFKNPLEMLFGGAQNSSQTSDTQEDGEIEKKRQDVERKLAAGLLEDEIVSIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSFMPKKTKKRKLSVKEARKLLTNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGSNVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSTDDFVKILIEPDNALIKQYMALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTIMEKLLEDLSFEASEITLEKITITPQYVEEKLASIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.183 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLAENLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMVVKVQDKAEEQANQRLVEILVPSPEKQSGFKNPLEMLFGGAQNSNQTTDSQEDVEIEKKRQDVERKLAAGLLEDEIVSIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSFMPKKTKKRKLSVKEARKVLTNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGSNVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSTDDFVKILIEPDNALIKQYMALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTIMEKLLEDLSFEASEITLEKITITPQYVEEKLATIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.211 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLAENLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMVVKVQDKAEEQANQRLVEILVPSPEKQSGFKNPLEMLFGGAQNSNQTSDTQEDVEIEKKRQDVERKLAAGLLEEEIVSIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSFMPKKTKKRKLSVKEARKLLTNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGSNVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSTDDFVKILIEPDNALIKQYMALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTIMEKLLEDLSFEASEITLEKITITPQYVEEKLATIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.165 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLAENLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMVVKVQDKAEEQANQRLVEILVPSPEKQSGFKNPLEMLFGGAQNSNQTTDSQEDVEIEKKRQDVERKLAAGLLEDEIVSIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSFMPKKTKKRKLSVKEARKVLTNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGSNVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSTDDFVKILIEPDNALIKQYIALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTIMEKLLEDLSFEASEITLEKITITPQYVEEKLATIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.191 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLPEDLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMMVKVKDKAEEQANQRLVEILVPSPQKQTGFKNPLEMLFGGNQNVNQTSESQDDTEIQKKRQEVEKQLAAGLLEEEIVSIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSFMPKKTKKRKLSVKEARKVLTNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGANVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSVDDFVKILIEPDNALVKQYAALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTIMEKLLEDLSFEASEITLEKVTITPQYVEEKLATIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.165 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLAENLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMVVKVQDKAEEQANQRLVEILVPSPEKQSGFKNPLEMLFGGAQNSNQTTDSQEDVEIEKKRQDVERKLAAGLLEDEIVSIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSFMPKKTKKRKLSVKEARKVLTNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGSNVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSTDDFVKILIEPDNALIKQYIALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTIMEKLLEDLSFEASEITLEKITITPQYVEEKLATIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.197 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLAENLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMVVKVQDKAEEQANQRLVEILVPSPEKQSGFKNPLEMLFGGAQNSNQTSDTQEDVEIEKKRQDVERKLAAGLLEEEIVSIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSFMPKKTKKRKLSVKEARKLLSNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGSNVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSTDDFVKILIEPDNALIKQYMALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTIMEKLLEDLSFEASEITLEKITITPQYVEEKLATIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.213 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLAENLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMVVKVQDKAEEQANQRLVEILVPSPEKQSGFKNPLEMLFGGTQNSNQTTDSQEDVEIEKKRQDVERKLAAGLLEDEIVSIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSFMPKKTKKRKLSVKEARKVLTNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGSNVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSTDDFVKILIEPDNALIKQYMALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTIMEKLLEDLSFEASEITLEKITITPQYVEEKLATIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.213 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLAENLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMVVKVQDKAEEQANQRLVEILVPSPEKQSGFKNPLEMLFGGTQNSNQTTDSQEDVEIEKKRQDVERKLAAGLLEDEIVSIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSFMPKKTKKRKLSVKEARKVLTNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGSNVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSTDDFVKILIEPDNALIKQYMALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTIMEKLLEDLSFEASEITLEKITITPQYVEEKLATIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.292 kDa

MTSTLTPREIVERLNQYIVGQDGAKRSVAVALRNRYRRTKLDPSMREEITPKNILMIGPTGVGKTEIARRLAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVESSVRLVKEERVALVKDEAKQLADKRLIELLVPSMKKETNYKNPFEMLFSQPDKEEEEDGEEELTRANLKRKMAEKLKQGELEERTVTVEVTEQNHGFMDLFQGGAGMEQMGMNMQEMLSNMMPKKKKKRRMTVAEARGVLAEEEAQKLIDMDDVTQEAITRAEQLGIIFIDEIDKVAGKNDQGANVSREGVQRDILPIVEGSTVVTKYGAVKTDHILFIAAGAFHMAKPADLIPELQGRFPIRVELQSLSVDDFVRILVEPDNALTKQYEALLQTEGIEMKFSDEAVRKIATIASEVNQETENIGARRLHTLLEKLLEDLSFEAADIHLETLEITEQYVEEKLGSIAKNRDLSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

463 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.146 kDa

MHLHFTPRQIVEKLDQYIIGQKDAKKAVAVALRNRYRRSKLVENLRDEIAPKNILMIGPTGVGKTEVARRMAKLVGAPFIKVEATKFTEVGYVGRDVESMVRDLVETSVRIVKEEMVVKVQDKAEEQANQRLVEILVPSPEKQSGFKNPLEMLFGGNQNSNQTSDAQEDDEIEKKRQDVERKLAAGLLEDEVISIEVTEQQSSMFDMLQGTGMEQMGMNFQDALGSIMPKKTKKRKLSVKEARKLLTNEEAQRLIDMDEVTQEAVYRAEQLGIIFIDEIDKIAGKQSNSVDVSREGVQRDILPIVEGSNVATKYGSVKTDYILFVAAGAFHMSKPSDLIPELQGRFPIRVELTKLSADDFVKILIEPDNALIKQYTALLATEGIEIEFSDEAIRKIAEIAYQVNQDTDNIGARRLHTVMEKLLEDLSFEASEITLEKITITPQYVEEKLATIAKNKDVSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

462 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.608 kDa

MTNFDNLTPKEIVRELDKYIIGQYQAKKAVAIAIRNRIRRQKLPDIWQKEVLPKNILMIGPTGVGKTEIARRLAQLSGSPFLKVEATRFTEVGYVGKNVDSMVRDLVEISVNMVKKERMEQVKDKAEQMVEERILDALIPESRKPQNISFMGLFTASQQQQPSPEERRSLRQKREEIRQKLRNGELENEMIEIEIEKEISPFIGALGQGELEDLGIDLGSMLGSLMPKTRQKKRMTVSEARRTLLPIESEKLIDMDKATQEALERAQNRGIIFIDELDKIAVKSSGSGPDVSRQGVQRDLLPIVEGTTIMTKYGPVRTDYILFIGSGAFHMSRPSDLIPELQGRFPIRVELSSLTRKDFVRILVEPENAITKQYQALLSTEGIELIFTEDGIEEMAKIAYELNQRLENIGARRLYTVVEKVLEEISFEAPDVQEKKIIIDAKYVMGKLENIISDEDVSSYIL

hslU

ATP-dependent protease ATPase subunit HslU

462 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.608 kDa

MTNFDNLTPKEIVRELDKYIIGQYQAKKAVAIAIRNRIRRQKLPDIWQKEVLPKNILMIGPTGVGKTEIARRLAQLSGSPFLKVEATRFTEVGYVGKNVDSMVRDLVEISVNMVKKERMEQVKDKAEQMVEERILDALIPESRKPQNISFMGLFTASQQQQPSPEERRSLRQKREEIRQKLRNGELENEMIEIEIEKEISPFIGALGQGELEDLGIDLGSMLGSLMPKTRQKKRMTVSEARRTLLPIESEKLIDMDKATQEALERAQNRGIIFIDELDKIAVKSSGSGPDVSRQGVQRDLLPIVEGTTIMTKYGPVRTDYILFIGSGAFHMSRPSDLIPELQGRFPIRVELSSLTRKDFVRILVEPENAITKQYQALLSTEGIELIFTEDGIEEMAKIAYELNQRLENIGARRLYTVVEKVLEEISFEAPDVQEKKIIIDAKYVMGKLENIISDEDVSSYIL

hslU

ATP-dependent protease ATPase subunit HslU

461 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.452 kDa

MSEFTPREIVSELDRYIIGQNMAKRAVAIALRNRWRRQRLSAEMREEVYPKNILMIGPTGVGKTEIARRLAKLARAPFIKVEATKFTEVGYVGRDVESIVRDLVEMGITMVTEEAKVKVQFQAEDQAEERLLDILLPLPSTGQGEGSAHFGLFGQMEGSSVKPEPTAQQKESRQKMRKMLREGKLDDREIDIDLKEQRRVPMMEVITPQGMEGINLQDMLGGLMGGRTKTRRVKVGEAMKLLTEEEAGKLVDQDTVQQVAIERVEQSGIVFLDELDKVCARGSETRGGDVSREGVQRDLLPLVEGTTVSTKYGMVKSDHILFIASGAFQLAKPSDLLPELQGRLPIRVELESLGKGEFVRILTEPENALTRQYAALMGVENIELVFTDEGIEALAEIATRVNETAENIGARRLHTVMEKLLDELSFSAPDRGGERVVIDAAYVNRQLSDLAADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

461 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.514 kDa

MENLTPRQIVEYLDKYIIGQEAAKKAVAVALRNRYRRKLLPPHLKDEIIPKNILMIGPTGVGKTEIARRLAKLIKAPFVKVEATKFTEVGYVGRDVEGMIRDLVETSLRMVREEKIKMVEDKAYNLAVERLSEIMIPNPKKENIKNPFEMFFGGIREDAAKTDPAYDELNYRRRELQDKIKKGFLDNEMVEIEVEEQKTPMVEVFGVGGIEEMGLNFQDILGGLIPPRRKKRRVTVKEALKILTQQEAQKLIDMDEVQREAIKRAEEDGIVFLDEIDKIASTGNTHGPDVSRGGVQRDILPIVEGSTVLTKYGPVKTDHILFIAAGAFHMSKPSDLIPELQGRFPIRVELKSLTVEDFKKILTVPENALTKQYVELLATEGVNLKFTEDSLEEIAKMAYTVNERNENIGARRLITILEKVLEDLSFNAPEMWGQTVVIDRKFVQDKLSEIVHDSDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

461 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.624 kDa

MRNVKNYTPKEIVAELDKYIVGQKEAKKSVAVALRNRYRRSLLPEDFKEEVTPKNILMVGPTGVGKTEIARRIAKLVEAPFVKVEATKFTEVGYVGRDVDSMVRDLVEAAVRMVKEEKLKAVTEKAKKLAEERLIDYLLGKKKKQPKNPFEMIFNYPSSERTEEPDNVDSYKREEIRQRLRSGELDNHMVEIEVTDTTPPMLEMYTNLGAEELNITLQDMFSDLLPKKKKLRKVTVAEAKKILEAEEAQNLIDMDEVIEEAVKRAENDGIIFIDEIDKIASTGYSAGPDVSREGVQRDLLPIIEGCTVMTKYGPVKTDYILFIAAGAFNVAKVSDLIPELQGRFPIRVNLKPLTKEDFVRILKEPKNALTKQYQELLRTEGVEIKYTEEAIETIAEVAYLINQQSEDIGARRLHTVMEKLFEDLSFHAPELSGQEIVITADYVKEQLKDSLNKYEVNKYIL

hslU

ATP-dependent protease ATPase subunit HslU

459 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.47 kDa

MSDFDKLTPKQIVEELDKYIVGQSKAKKAVAIAIRNRIRRQKLSEEWKKEITPKNILMIGPTGVGKTEIARRLAQLSGSPFLKIEATRFTEVGYVGKNVDSMIRELVEIAVNMVKQQKMKEVEEKAKLNVEERILDALVPMKKKTQIPFANIFGMQMEKPQQTDDYSENLRKREELRRRLRSGELDNEEIEIEIETSNSPIGFIGLPEMEDIGMDLSNVIGNIFPKQKKRRKMKISEAKKVLLPIEEEKLIDMDETIQTALELAQNRGIIFIDEMDKIAAKTGSSGQDVSRQGVQRDLLPIVEGTTITTKYGPVKTDYILFIAAGAFHVSKPSDLIPELQGRFPIRVELEPLKEEDFVRILVEPENALTKQYQALLYTENVQLEFTDDGIKELARVSYKLNQKLENIGARRLYTVLEKVLEDVLFEAPEIEEKIIVDADYVTKKLKGIIEDEDLTSYIL

hslU

ATP-dependent protease ATPase subunit HslU

459 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.567 kDa

MKNYTPKEIVEELDKYIVGQKEAKKSVAVALRNRYRRNLLPDDFKEEVTPKNIIMVGPTGVGKTEIARRIAKLVEAPFVKVEATKFTEVGYVGRDVDSMVRDLVEAAVRMVKEEKLKKVTEKAKKIAEDRLIDYIIGKRKKQTKNPFEVLFNYPSAEKSEETEEESMQYKREEIRQKLRNGELDNYVVEIEVTDTSTPMLEMYTNLGSEEMNINLQDIFADILPKKKKIKKVPVYEAKRILESEEAQNLIDMDEVIEEAIKRAENDGIIFIDEIDKIASSGYTAGPDVSREGVQRDILPIIEGCTVMTKYGPVKTDHILFIAAGAFNVAKVSDLIPELQGRFPVRVNLKPLTKEDFIRILKEPKNALTKQYQELLRTEGIEVKYTDEAIEAIAEVAYLINQQSEDIGARRLHTVMEKLFEELSFNAPELGGQQIVITEEYVKEQLKDSLNKYEVSKYIL

hslU

ATP-dependent protease ATPase subunit HslU

459 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.618 kDa

MKNYTPKEIVEELDKYIVGQKEAKKSVAVALRNRYRRNLLSDDFKEEVTPKNIIMVGPTGVGKTEIARRIAKLVEAPFVKVEATKFTEVGYVGRDVDSMVRDLVEAAVRMVKEEKLKKVTEKAKKIAEDRLIDYIVGKRKKQAKNPFEMLFNYPAAEKSEETEEESMQYKREEIRQKLRNGELDNYVVEIEVTDTSTPMMEMYTNLGSEEMNINLQDIFADILPKKKKIKKVPVYEAKRILESEEAQNLIDMDEVIEEAIKRAENDGIIFIDEIDKIASSGYTAGPDVSREGVQRDILPIIEGCTVMTKYGPVKTDHILFIAAGAFNIAKVSDLIPELQGRFPVRVSLKPLTKEDFIRILKEPKNALTKQYQELLRTEGIEVKYTDEAIEAIAEVAYLINQQSEDIGARRLHTVMEKLFEELSFNAPDLKGQQIVITEEYVKEQLKDSLNKYEVNKYIL

hslU

ATP-dependent protease ATPase subunit HslU

459 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.896 kDa

MSAFTPREVVSELDRYIVGQNAAKRAVAIALRNRWRRQQVDDDLRDEIHPKNIIMIGPTGVGKTEIARRLAKLAQAPFVKVEASKFTEVGYVGRDVESMIRDLVEAAIALVREEETEKVGPRAEELAEDRLIELMQGGGVKSSSATPPFGFAPPPPPPVQRVSDSAREKFRAQLRAGTLDDVEVEVETAESSPTFMRGFSGQGMEEIGVNLQDLFKNVPGMNKTRRRRVRVPEALQLLRKEEAAKLVDPDRVQREAVARAEMNGIIFIDEIDKIASREGGKGGGGPDVSREGVQRDILPIVEGSTINTKYGVVKTDHMLFIAAGAFHVSKPSDLIPELQGRFPIRVELEPLTGEDLVRILREPKNSLLRQYTALLSTEGVRLSFTDDAVTELARIAQQANESTANIGARRLHTILERLLDEVSFSASEMGPRDFQVDAAYVRERLAAIVQDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

459 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.489 kDa

MPSKTDFTSSTMTPREIVQELDRHIVGQQAAKRSVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARRLATLANAPFVKVEATRFTEVGYVGKDVEQIGRDLVDTAVKMYREQAKVRVRTQAEEYAEERILDALLPRRSVGIGFDADADAIRQEPSAHESETRAKFRRMLRSGELEEREIELDVAVNVSMDIMTPPGMEEMGQQLRQMFSNIGGGKSQKRKLAIKAARPLLIEEEAAKLVNEDEIRAAAIEACEQNGIVFIDEIDKVVKRGDTVGGGDVSREGVQRDLLPLVEGSNVSTKYGTIRTNHILFIASGAFHLTKPSDLIPELQGRFPIRVELDALSKADFIRILTEPKAALTKQYQELLKTEGVSLDFTEDAIDRIAEIAYLVNERQENIGARRLHTVLERLLETLSYESPDRDGESVTVDADYVNAHLGELVKDPDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

459 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.633 kDa

MPSKTDFTSSTMTPREIVQELDRHIVGQQAAKRSVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARRLATLANAPFVKVEATRFTEVGYVGKDVEQIGRDLVDTAVKMYREQAKVRVRTQAEEYAEERILDVLLPRRSVGIGFDVDADVIRQEPSAHESETRAKFRRMLRSGELEEREIELDVAVNVSMDIMTPPGMEEMGQQLRQMFSNIGGGKSQKRKLTIKAARPLLIEEEAAKLVNEDEIRAAAIEACEQNGIVFIDEIDKVVKRGDTVGGGDVSREGVQRDLLPLVEGSNVSTKYGTIRTNHILFIASGAFHLTKPSDLIPELQGRFPIRVELDALSKADFIRILTEPKAALTKQYQELLKTEGVSLDFTEDAIDRIAEIAYLVNERQENIGARRLHTVLERLLEMLSYESPDRDGESVTVDADYVNAHLGELVKDPDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

459 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.603 kDa

MPSKTDFTSSTMTPREIVQELDRHIVGQQVAKRSVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARRLATLANAPFVKVEATRFTEVGYVGKDVEQIGRDLVDTAVKMYREQAKVRVRTQVEEYAEERILDALLPRRSVGIGFDVDADVIRQEPSAHDSETRAKFRRMLRSGELEDREIELDVAVNVSMDIMTPPGMEEMGQQLRQMFSNIGGGKSQKRKLTIKAARPLLIEEEAAKLVNEDEIRAAAIEACEQNGIVFIDEIDKVVKRGDTVGGGDVSREGVQRDLLPLVEGSNVSTKYGTIRTNHILFIASGAFHLTKPSDLIPELQGRFPIRVELDALSKADFIRILTEPKAALTKQYQELLKTEGVSLDFTEDAIDRIAEIAYLVNERQENIGARRLHTVLERLLETLSYESPDRDGESVTVDADYVNAHLGELVKDPDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

458 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

52.211 kDa

MEQLTPRETVRELDRYIVGQNQAKRAVAIALRNRYRRSLLPEGMQEEVLPKNILMIGPTGVGKTEIARRLAKLVRAPFLKVEATKFTEVGYVGRDVESIVRDLVEISLRMVKAEKMEEVEIQAAQAAEKRLEALLVPGKRQENNSSNPFQFLFNQGQEKEETVTPEIERDRTFIRERLHRGELDEQVIEVEVEDNQPLLPDFLGTGMEINTNLQDMMAGMLPKKRHKRKVTVREARRILTTEEAQKLIDHDEAVQEAIRRVEQEGMVFLDEIDKIAGRDGASGPDVSRGGVQRDILPIVEGSTINTKYGPVKTDHILFIAAGAFHVAKPSDLIPELQGRFPIRVELESLSIEDFQRILTEPQSSLIKQYSALLETEGIKVEFTENAIDELAKVAYEVNSNTENIGARRLHTIVERVLEELSFEASELPEDYTVTINREYIQHRLGNIVRNQDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

457 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.817 kDa

MSNLTPREIVSELDKFIIGQSDAKRMVAIAMRNRWRRQQLPPELRDEIAPKNIIMMGPTGVGKTEIARRLAKLAGCPFFKVEATKFTEVGYVGRDVESMVRDLMEIGINLVRKEEMEKVKVKAEKHAEDALLDILLPSSKPKQPGMGFFNPAAPEEQEEQPSADQSSTREKFRKMWREGKLDDREVEIEVSVQGGGVEIMSMPGMEDMGMQVNDMIGKMFPNKKKMRKVKIREAYDILIQQESDKLIDMDNVAELARERVEQGGILFLDEIDKIAGNQEGGGSANVSREGVQRDLLPVVEGCVVNTKYGMVKTDHILFISAGAFSYAKPSDLIPELQGRFPLRVELTSLDKDDFYRILTEPQNALTVQYKALLETENLNIDFSREALEEVALNAQKFNEETENIGARRLYTIMEKILSDLSFEAPDRSGDSIVIDKEYVQKQLQDVTEDRDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

457 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.829 kDa

MEDLKPREIVQELDKYIIGQDHAKRFVAIALRNRWRRRQVPQDLRDEIAPKNIILIGPTGVGKTEISRRLAKLADVPFLKVEATKFTEVGYVGRDVESMIRDLVEVTVNMVREKEEDEVALPAMKAAEERILDILLPPRRETQPFADAEGETTLEIVTRGDSNQDSTREKLRKMLHSGKFDDRYVDLEINERNTPVVEIFSNMGMEEVGFNFKDMLGGLMPKNTKKRKVKVSEAMEILTQQEAQGLIDMEKVVKKALSRVEESGIIFLDEIDKIAVGGGKGQGPDVSREGVQRDLLPIVEGTTVNTKYGMVKTDHILFIASGAFHMTKPSDLTPELQGRFPIRVELDSLTEHDFMRILTEPKNAIMLQYQELLKTEGVELVFTQDSVAEIASIAKEVNDRTENIGARRLHTVMECLLEDILYDAPEVPEKKITIGAEMVRAKLESIKEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

457 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.801 kDa

MTISSSLTPKETLAELDRYIVGQAAAKRSVAIALRNRWRRQQVPSPLREEIAPKNIIMIGPTGVGKTEIARRLASLAQSPFIKVEASKFTEVGYVGRDVESMIRDLVELAISMVKDEEKKRIEGLAEANAEDRILDLLLPPTPVHSESSVDLLPASADVSAAGSSTKEKFRQMLRDGKLDEREVEVEVTETSQAPMVEVMGVSGMDDMQSNIQDAFSRMFPKKTKQSKMKVPDALDVLTKEEMEKLVDMEMVLKEALRRTEQSGIVFLDEIDKVASKGGSSHGPEVSREGVQRDLLPIVEGATVSTKYGMVKTDHILFIASGAFHVAKPSDLIPELQGRFPIRVELESLGKDEFVRILTEPENALTKQYIALLATEGVTLRFEDEAIEEIATIAVQVNESTEEIGARRLHTVVERVLDVLSFDACEREESEFVVTAQYVRDQLSEIAEDQDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

456 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.245 kDa

MSDLTPAEIVIELDKYIVGQAKAKRSVAIALRNRWRRRQVPEAMREEIAPKNIILIGPTGVGKTEIARRLARLTDSPFLKIEASKFTEVGYVGRDVESMVRDLVELTVTHLKVSEREAVREKAVRLAEERILDVLLPRPEGPQRADGDEPLGSHIEIVSDDDGRVSTREKLRTMLRAGKLKDRYVDLELADRSMPMVEIFSNSGLEEMGVNFKDMFAGLLPKNKKRRKVKVPEALEMLTDEEAQNLVDMDRVVRMAVEKVEQSGIIFLDEIDKIVATSKGSGPDVSREGVQRDLLPIVEGSTVMTKHGAVKTDHILFIASGAFHMCKPSDLIPELQGRFPIRVELDALGKEEFFRILIEPENALLLQYIELLRTEGVDVAFADEAVREIAAMAEEVNAGTENIGARRLHTLMEYLLEDLLFDAPDRAGTKVAIDRAYVTDRLKTIRGNEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

456 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.08 kDa

MHEFTPRQIVEKLNEHVIGQADAKRAVAIALRNRYRRQLLDPSLRDEVTPKNILMIGPTGVGKTEIARRLAKLVRAPFVKIEATKFTEVGYVGRDVESMVRDLVEASLRLVKDEKKEALKERAEAVANERIVDALVGKKASTGLGGGNPFEMLFGGTQKPPEQETANDTADRSVIRQQLFQGQLEDRMIDVDIEERQMDLFSGQQGMEGLANLQDMLGQVMPKKTKKRQLSVKEARPILTAEEAERLLDLNEVHDEAVRRAEQMGIIFVDEIDKIATKGQDSAGVSREGVQRDILPIVEGSTVVTKYGPVKTDHMLFIAAGAFHMAKPSDLIPELQGRFPIRVELDSLTEDDFVKILTEPNQALLKQYKALLGAEQVHVTFTEDAIRQIARIAAQVNDETDNIGARRLYTIMERVLEELSFEAAEMPETDVTITPQYVMDRVGKVADDRDLSQFIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.16 kDa

MTQVMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDDEMRQEVTPKNILMIGPTGVGKTEIARRLAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMKREEAKQKVTEKAAILAEDRILDVLIPPARASESKVGFANEPAEDAQSKKEKENKTREIFRKKIQNGELNDKEIEIEVSVAPKSIGVMGPPGMEDMTNQLQDLFSSLSSDKKKTKKMRIKDAIKLVKDEEAAKLINEEDIKARALESVEQNGIVFLDEIDKVCKKSGTSGADVSREGVQRDLLPLVEGSTVSTKYGMIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIEDFVRILKEPDCSILKQYIALMKTEGVELSFEEDAIRKIAEISFQVNEEVENIGARRLHTVMERLLEEISFDAPDLENKSINITTDYINEKLSGLVKNKNLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.237 kDa

MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARRLAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMKREEAKEKVTEKAARLAEDRILDVLIPPARTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQNGELDDKEIEIEVAVAPKTIGVMGPPGMEDMTSQLQDLFSSLSTDKKKNKKMRIKDAIKLAQDEEAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNSGADVSREGVQRDLLPLVEGSTVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIEDFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISFDAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.237 kDa

MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARRLAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMKREEAKEKVTEKAARLAEDRILDVLIPPARTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQNGELDDKEIEIEVAVAPKTIGVMGPPGMEDMTSQLQDLFSSLSTDKKKNKKMRIKDAIKLAQDEEAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNSGADVSREGVQRDLLPLVEGSTVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIEDFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISFDAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.237 kDa

MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARRLAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMKREEAKEKVTEKAARLAEDRILDVLIPPARTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQNGELDDKEIEIEVAVAPKTIGVMGPPGMEDMTSQLQDLFSSLSTDKKKNKKMRIKDAIKLAQDEEAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNSGADVSREGVQRDLLPLVEGSTVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIEDFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISFDAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.237 kDa

MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARRLAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMKREEAKEKVTEKAARLAEDRILDVLIPPARTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQNGELDDKEIEIEVAVAPKTIGVMGPPGMEDMTSQLQDLFSSLSTDKKKNKKMRIKDAIKLAQDEEAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNSGADVSREGVQRDLLPLVEGSTVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIEDFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISFDAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.27 kDa

MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARRLAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMKREEAKEKVTEKAARLAEDRILDVLIPPARTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQKGELDDKEIEIEVAVAPKTIGVMGPPGMEDMTSQLQDLFSSLSTDKKKNKKMRIKDAIKLAQDEEAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNSGADVSREGVQRDLLPLVEGSTVSTKYGMIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIEDFVRILREPDCSILKQYIALMKTEGVDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEEISFDAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.237 kDa

MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARRLAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMKREEAKEKVTEKAARLAEDRILDVLIPPARTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQNGELDDKEIEIEVAVAPKTIGVMGPPGMEDMTSQLQDLFSSLSTDKKKNKKMRIKDAIKLAQDEEAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNSGADVSREGVQRDLLPLVEGSTVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIEDFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISFDAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.237 kDa

MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARRLAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMKREEAKEKVTEKAARLAEDRILDVLIPPARTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQNGELDDKEIEIEVAVAPKTIGVMGPPGMEDMTSQLQDLFSSLSTDKKKNKKMRIKDAIKLAQDEEAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNSGADVSREGVQRDLLPLVEGSTVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIEDFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISFDAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.237 kDa

MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARRLAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMKREEAKEKVTEKAARLAEDRILDVLIPPARTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQNGELDDKEIEIEVAVAPKTIGVMGPPGMEDMTSQLQDLFSSLSTDKKKNKKMRIKDAIKLAQDEEAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNSGADVSREGVQRDLLPLVEGSTVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIEDFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISFDAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.713 kDa

MPNIDTATMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARRLATLANAPFVKVEATRFTEVGYVGKDVEQIIRDLADTAVKLYREQAKVRVRNQAEERAEDRILDALLPRRATGIGFDPEAARNEPSSQDNDTRIKFRRMLRNGELDEREIELEVAVNASMDIMTPPGMEEMGQQLRQMFSNLGSGKSQKRKLTIKAARPLLIEEEAGKLVNEDDVRTAAIEACEQHGIVFIDEIDKVAKRGEAGSSGGDVSREGVQRDLLPLVEGSNVSTKYGTVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELTALTKADFVRILTEPKAALIKQYEALLQTEGVALTFASDAVDRLAEIAAQVNERQENIGARRLHTVLERLLDVLSYEAPDRDGQSVTVDAAYVDAQLGELVQDPDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.693 kDa

MPNPDTATMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARRLATLANAPFVKVEATRFTEVGYVGKDVEQIIRDLADTSVKLYREQAKVRVRNQAEERAEDRILDALLPRRAAGIGFDPEAARNEPSSQDNETRIKFRRMLRNGELDEREIELDVAVNASMDIMTPPGMEEMGQQLRQMFSNLGSGKSQKRKLTIKAARPLLIEEEAGKLVNEDDVRTAAIEACEQHGIVFIDEIDKVAKRGEAGSSGGDVSREGVQRDLLPLVEGSNVSTKYGTVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELTALTKADFVRILTEPKAALIKQYEALLQTEGVALTFAPDAVDRLAEIAAQVNERQENIGARRLHTVLERLLDVLSYEAPDRDGQSVTVDAAYVDAQLGELVQDPDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.69 kDa

MPNIDTATMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARRLATLANAPFVKVEATRFTEVGYVGKDVEQIIRDLADTSVKLYREQAKVRVRNQAEERAEDRILDALLPRRSAGIGFDPEAARHEPSAQDNETRIKFRRMLRNGELDEREIELEVAVNASMDIMTPPGMEEMGQQLRQMFSNLGGGKSQKRKLTIKAARPLLIEEEAGKLVNEDDIRTAAIEACEQHGIVFIDEIDKVAKRGEAGSSGGDVSREGVQRDLLPLVEGSNVSTKYGTVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELTALTKADFVRILTEPKAALIKQYEALLQTEGVALTFGADAVDRLAEIAAQVNERQENIGARRLHTVLERLLDVLSYEAPDRDGQSVTVDAAYVDAQLGELVQDPDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.69 kDa

MPNIDTATMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARRLATLANAPFVKVEATRFTEVGYVGKDVEQIIRDLADTSVKLYREQAKVRVRNQAEERAEDRILDALLPRRSAGIGFDPEAARHEPSAQDNETRIKFRRMLRNGELDEREIELEVAVNASMDIMTPPGMEEMGQQLRQMFSNLGGGKSQKRKLTIKAARPLLIEEEAGKLVNEDDIRTAAIEACEQHGIVFIDEIDKVAKRGEAGSSGGDVSREGVQRDLLPLVEGSNVSTKYGTVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELTALTKADFVRILTEPKAALIKQYEALLQTEGVALTFGADAVDRLAEIAAQVNERQENIGARRLHTVLERLLDVLSYEAPDRDGQSVTVDAAYVDAQLGELVQDPDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.69 kDa

MPNIDTATMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARRLATLANAPFVKVEATRFTEVGYVGKDVEQIIRDLADTSVKLYREQAKVRVRNQAEERAEDRILDALLPRRSAGIGFDPEAARHEPSAQDNETRIKFRRMLRNGELDEREIELEVAVNASMDIMTPPGMEEMGQQLRQMFSNLGGGKSQKRKLTIKAARPLLIEEEAGKLVNEDDIRTAAIEACEQHGIVFIDEIDKVAKRGEAGSSGGDVSREGVQRDLLPLVEGSNVSTKYGTVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELTALTKADFVRILTEPKAALIKQYEALLQTEGVALTFGADAVDRLAEIAAQVNERQENIGARRLHTVLERLLDVLSYEAPDRDGQSVTVDAAYVDAQLGELVQDPDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.773 kDa

MPNPDTSTMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARRLATLANAPFVKVEATRFTEVGYVGKDVEQIIRDLADTSVKLYREQAKVRVRNQAEERAEDCILDALLPRRATGIGFDPEAARNEPSSQENDTRIKFRRMLRNGELDEREIELEVAVNASMDIMTPPGMEEMGQQLRQMFSNLGSGKSQKRKLTIKAARPLLIEEEAGKLVNEDDVRTAAIKACEQHGIVFIDEIDKVAKRGEAGSNGGDVSREGVQRDLLPLVEGSNVSTKYGTVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELTALTKADFVRILTEPKAALIKQYEALLQTEGVSLTFAQDAVDRLAEIAAQVNERQENIGARRLHTVLERLLDVLSYEAPDRDGQSVTVDAAYVDAQLGELVQDPDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

455 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.773 kDa

MPNPDTSTMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARRLATLANAPFVKVEATRFTEVGYVGKDVEQIIRDLADTSVKLYREQAKVRVRNQAEERAEDCILDALLPRRATGIGFDPEAARNEPSSQENDTRIKFRRMLRNGELDEREIELEVAVNASMDIMTPPGMEEMGQQLRQMFSNLGSGKSQKRKLTIKAARPLLIEEEAGKLVNEDDVRTAAIKACEQHGIVFIDEIDKVAKRGEAGSNGGDVSREGVQRDLLPLVEGSNVSTKYGTVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELTALTKADFVRILTEPKAALIKQYEALLQTEGVSLTFAQDAVDRLAEIAAQVNERQENIGARRLHTVLERLLDVLSYEAPDRDGQSVTVDAAYVDAQLGELVQDPDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

453 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.79 kDa

MSDLKPMEIVRELDRYIIGQKNAKKSVAIALRNRWRRRQVPDDLRDEIAPKNIILIGPTGVGKTEIARRLARLTDSPFYKVEASKFTEVGYVGRDVESMIRDLMELTVNTLKVRQQEEVQEKAAAMAEERILDLLLPESGGPEGATLTEPHLEVVSSSSSKSSTREKLRKMLNNGKLDSRFVDIDVTGKASPMIEIFSNTGMEEMGINMKDMLGNLLPKNTKRRKVKVAEAMKILTQDEAAHLVDMEKVTADAVEMVEQSGIIFLDEIDKIAGKGNSQGPEVSKEGVQRDLLPIVEGSSVPTKYGTVKTDHILFIASGAFHIAKPSDLIPELQGRFPIRVELTSLGKDEFVRILTEPKNALILQYIALLRTEGVELEFTEDAIDKIASIAVDVNERTENIGARRLHTIMEKLLEEILFHAPDVEEKKMVVDADFVDKQLMEIVKDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

452 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.865 kDa

MKSTKTTNTNKKDPMGLTPSQIVNELNRFIVGQEKAKKAVAIALRNRGRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVGRDVESIIRDLVEIAVNTQKTIAKTEVDINAREKAIERVLESLVGKTSSSKTREKFQEKILSGELDDTEIEISVADTAPVGGGSFEIPGMPGASMGVLNLGDMIGRAFGTTKTKTKKMLVKEAMSIILSEESEKLIDQEKIIQQAINLVENDGIVFIDEIDKIASVANSGAKNSEISREGVQKDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELNSLTKEDMIKILLEPETSLIKQYSALIGTEKVELEFTNSAIEKIADYATTVNLEIEDIGARRLHTILENLLEDISFRASEMQGEKISIDDKFVENQLSKILTNLDLAKFVL

hslU

ATP-dependent protease ATPase subunit HslU

451 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.985 kDa

MEKLLGYRDLNMTPREIVEELDRHIIGQKHAKRAVANALRSRWRRKQVAEPLRSEITPKNILMIGPTGVGKTEIARRLAKLAEAPFIKVEATKFTEVGYVGRDVDSIIRDLVETSIKLEKNRAKERVKSKAREAALERVLDVLVPRKKQTAWTGEEEIDPARKMYRERILREEMNDTVIEIETNQSMSANVEIMTPPGMEEMSSQLSEMFKSFGREKKTKRKMTIAKALIQLAEEEAEALVSHEEIKSAAIDNAEQNGIVFIDEIDKVARRSDVGGADVSREGVQRDLLPLVEGCTISTKYGMIKTDHILFIASGAFHLAKPSDLIPELQGRLPVRVELDALTADDFKRILTEPDASLIKQYTALFATEQLHLEFTEDGINKIAEIAYHVNKTTENIGARRLHTLIERLTDSLSFDAADRRDGDRVIIDAAYVEKTLGEISNNEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

450 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.455 kDa

MTTKSLSELLEELTPKRVVEELNKYVVGQEEAKKAVAIALRNRWRRQKLPENLRNEVIPKNILMIGPTGVGKTEIARRLANLIKAPFVKVEATKYTEIGYVGRDVESMVRELVEVSFQMVKQEKMKEVRERARRLAEERLLDYLVPHQFTSFGIRESRDAGKREELRQKLRKGELDDRIVEIEVKEKTVPMVGIAGPPGLEELENQIKEMLSGLIPSKRRRKVKVKEALQILEQEEAEKLIDMEEVAREAIYRAENFGIIFIDEIDKIAVKTPGAGPGVSREGVQRDLLPILEGTTVNTKYGPVKTDHILFIGAGAFHMAKPSDLIPELQGRFPIRVELKPLTKEDFKRILVEPENALTKQYIELLKTENVYLEFTDDAIEEIARIAEEINTKTENIGARRLHTVMEKLLEDISFNAPEMAGQTIIIDAKFVKAKLENLVKDEELSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

450 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.553 kDa

MKATKTTYKKDPMGLTPSQIVNELNRFIVGQEKAKKAVAIALRNRCRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVGRDVESIIRDLVEIAVNTEKTLAKTKVDIHAREKAIERILDSLVGKTSSSETREKFKEKILNGELDDKEIEISVADTTPVGGGSFEIPGMPGASMGVLNLGDMIGRALGSSKTKTKKMLVKDAMAIIIPEESEKLIDQEKIIQQAINLAENDGIVFIDEIDKIASTGSSGAKNAAISREGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELNSLTKDDMIKILLEPETSLIKQYSALIGTEDVRLEFAASAIEKIADYAITVNLEVEDIGARRLHTILENLLEDISFEASEMKGKKITIDDKFVENQLSKIITNLDLAKFVL

hslU

ATP-dependent protease ATPase subunit HslU

450 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.64 kDa

MKATKTTYQKDHMGLTPSQIVNELNRFIVGQEKAKKAVAIALRNRCRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTYSPFYKIEATKFTEVGYVGRDVESIIRDLVEIAVNTEKTLAKTEVDINAREQAIERILDSLVGKTSSSETREKFKEKILNGELDDTEIEISVADTTPVGGGSFEIPGMPGASMGVLNLGDVIGRALGGSKTKTKKMLVKDAMAIIIPEESEKLIDQEKIIQQAINLAENDGIVFIDEIDKIASTGSSGAKNAEISREGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELNSLTKDDMIKILLEPETSLIKQYSALIGTEDVYIAFTDSAIEKIADYAITVNLEVEDIGARRLHTILENLLEDISFEASEMKGRKITIDDKFVENQLSKIITNLDLAKFVL

hslU

ATP-dependent protease ATPase subunit HslU

450 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.636 kDa

MKATKITYKKDPMGLTPAQIVNELNRFIVGQEKAKKAVAIALRNRCRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVGRDVESIIRDLVEIAVNTEKTLAKTEVDINAREKAIERILDSLVGKTSSSETREKFKEKVLNGELNDTEIEISVADTAPIGGGSFEIPGMPGSSMGVLNLGDMIGRALGSSKTKTKKMLVKEAMAIIIPEELEKLIDQEKIIQQAITLAENDGIVFIDEIDKIASAPSSGAKNAEISREGVQRDLLPLIEGTTVNTKYGQVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELNSLTKDDMIKILLEPETSLIKQYSALIGTEDVHLEFTASAIEKIADYAITVNLEVEDIGARRLHTILENLLEDISFEASEMKGKKITIDDQFVENQLSKIITNLDLAKFIL

hslU

ATP-dependent protease ATPase subunit HslU

450 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.592 kDa

MKATKTTYKKDPMGLTPSQIVNELNRFIVGQEKAKKAVAIALRNRCRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVGRDVESIIRDLVEIAVNTEKTLAKTKVDIHAREKAIERILDSLVGKTSSSETREKFKEKILNGELDDKEIEISVADTTPVGGGSFEIPGMPGASMGVLNLGDMIGRALGSSKTKTKKMLVKDAMAIIIPEESEKLIDQEKIIQQAINLAENDGIVFIDEIDKIASTGSSGAKNAEISREGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELNSLTKDDMIKILLEPETSLIKQYSALIGTEDVHLEFAASAIEKIADYAITVNLEVEDIGARRLHTILENLLEDISFEASEMKGKKITIDDKFVENQLSKIITNLDLAKFVL

hslU

ATP-dependent protease ATPase subunit HslU

450 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.557 kDa

MKATKTTYKKDPMGLTPSQIVNELNRFIVGQEKAKKAVAIALRNRCRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVGRDVESIIRDLVEIAVNTKKTLAKMEVDINAREKAIERILDSLVGKTSSSETREKFKEKILNGKLDDTEIEISVADTTPVGGGSFEIPGMPGASMGVLNLGDMIGRALGSSKTKTKKMLVKDAMAIIIPEESEKLIDQEKIIQQAINLAENDGIVFIDEIDKIASTGSSGAKNAEISREGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELNSLTKDDMIKILLEPETSLVKQYSALIGTEDVHLEFAASAIEKIADYAITVNLEVEDIGARRLHTILENLLEDISFEASEMKGKKITIDDKFVENQLSKIITNLDLAKFVL

hslU

ATP-dependent protease ATPase subunit HslU

450 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.556 kDa

MKATKTTYKKDPMGLTPSQIVNELNRFIVGQEKAKKAVAIALRNRCRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVGRDVESIMRDLVEIAVNTEKTLAKTKVDINAREKAIERILDSLVGKTSSSETREKFKEKILNGELDDTEIEISVADTTPVGSGSFEIPGMPGASMGVLNLGDMIGRALGSSKTKTKKMLVKDAMAIIIPEESEKLIDQEKIIQQAINLAENDGIVFIDEIDKIASTGSSGAKNAEISREGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELNSLTKDDMIKILLEPETSLIKQYSALIGTEDVCLEFAASAIEKIADYAITVNLEVEDIGARRLHTILENLLEDISFEASEMKGKKITIDDKFVENQLSKIITNLDLAKFVL

hslU

ATP-dependent protease ATPase subunit HslU

450 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.724 kDa

MKSTETTYKKDNMGLTPSQIVNELNRFIVGQDKAKKAVAIALRNRYRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVGRDVESIIRDLVEIAVNTEKALAKIAVDINAREKAIERILDSLVGKTSSSETREKFKAKVLNGELDDTEIEISVADTTPVGGGGFEIPCIPGASMGVLNLGDMIGRALGNSKTKTKKMLIKDAMTVIIPEESEKLIDQEKIIQKAINLAENDGIVFIDEIDKIASTSNAGAKNAEISREGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELNLLTKDDMIKILLEPETSLIKQYSALIGTEEVHLEFTDAAIEKIADYAITVNLEVEDIGARRLHTILENLLEDISFEASEMKVKKIIIDDKFVENQLSKIITNLDLAKFVL

hslU

ATP-dependent protease ATPase subunit HslU

450 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.584 kDa

MKATKTTYKKDPMGLTPSQIVNELNRFIVGQEKAKKAVAIALRNRCRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVGRDVESIIRDLVEIAVNTEKTLAKTKVDIHAREKAIERILDSLVGKTSSSETREKFKEKILNGELDDTEIEISVADTTPVGGGSFEIPGMPGASMGVLNLGDMIGRALGSSKTKTKKMLVKDAMAIIIPEESEKLIDQEKIIQQAINLAENDGIVFIDEIDKIASTGSSGAKNAEISREGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELNSLTKDDMIKILLEPETSLIKQYSALIGTEDVRLEFAASAIEKIADYAITVNLEVEDIGARRLHTILENLLEDISFEASEMKGKKITIDDKFVENQLSKIITNLDLAKFVL

hslU

ATP-dependent protease ATPase subunit HslU

450 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.656 kDa

MKATKTTYKKDPMGLTPSQIVNELNRFIVGQEKAKKAVAIALRNRCRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLATLTNSPFYKIEATKFTEVGYVGRDVESIIRDLVEIAVNTEKTLAKTKVDIHAREKAIERILDSLVGKTSSSETREKFKEKILNGELDDTEIEISVADTTPVGGGSFEIPGMPGASMGVLNLGDMIGRALGSSKTKTKKMLVKDAMAIIIPEESEKLIDQEKIIQQAINLAENDGIVFIDEIDKIASTGSSRAKNAEISREGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELNSLTKDDMIKILLEPETSLIKQYSALIGTEDVRLEFAASAIEKIADYAITVNLEVEDIGARRLHTILENLLEDISFEASEMKGKKITIDDKFVENQLSKIITNLDLAKFVL

hslU

ATP-dependent protease ATPase subunit HslU

450 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.656 kDa

MKATKTTYKKDPMGLTPSQIVNELNRFIVGQEKAKKAVAIALRNRCRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLATLTNSPFYKIEATKFTEVGYVGRDVESIIRDLVEIAVNTEKTLAKTKVDIHAREKAIERILDSLVGKTSSSETREKFKEKILNGELDDTEIEISVADTTPVGGGSFEIPGMPGASMGVLNLGDMIGRALGSSKTKTKKMLVKDAMAIIIPEESEKLIDQEKIIQQAINLAENDGIVFIDEIDKIASTGSSRAKNAEISREGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELNSLTKDDMIKILLEPETSLIKQYSALIGTEDVRLEFAASAIEKIADYAITVNLEVEDIGARRLHTILENLLEDISFEASEMKGKKITIDDKFVENQLSKIITNLDLAKFVL

hslU

ATP-dependent protease ATPase subunit HslU

450 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.743 kDa

MKSTETTCKKDNMGLTPSQIVNELNRFIVGQDKAKKAVAIALRNRYRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVGRDVESIIRDLVEIAVNTEKALAKIAVDINAREKAIERILDSLVGKTSSSETREKFKEKVLNGELDDTEIEISVADTTPVGGGSFEIPCIPGASMGVLNLGDMIGRALGSSKTKTKKMLIKDAMTVIIPEESEKLIDQEKIIQKAINLAENDGIVFIDEIDKIASTSNSGAKNAEVSREGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELNLLTKDDMIKILLEPETSLIKQYSALIGTEEVHLEFTDSAIEKIADYAITVNLEVEDIGARRLHTILENLLEDISFEASEMKVKKIIIDDKFVENQLSKIITNLDLAKFVL

hslU

ATP-dependent protease ATPase subunit HslU

450 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.828 kDa

MSEMTPREIVDELNRHIIGQDKAKRAVAVALRNRWRRMQLDDELRQEVTPKNILMIGPTGVGKTEIARRLAKLARAPFIKVEATKFTEVGYVGKEIESIIKDLTDVAVKQTREEMMQKVRYRAEEAAEERILDVLLPPAKTSSSGWAQQQEETPENDDQRGTRQVFRKKLREGQLDDKEIEIDLAMPQMGVEIMAPPGMEEMTSQLQNMFQNMGSDKTKARKMRIKDAYKQLVDEEAAKLLNPDDVKEAAIESVEQNGIVFLDEIDKICKRGDTSGPDVSREGVQRDLLPLVEGTTVNTKHGMIKTDHILFIASGAFQMSKPSDLIPELQGRLPIRVELEALTSGDFVRILTEPSASLTTQYHALLNTEGVEVSFTEEGIQRIAEVAFHVNETTENIGARRLHTVLERLMEEISFHATDHSGEKLVIDADYVNEHVGELSQDEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

449 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.782 kDa

MSVLTPREIVSELDKYIIGQEQAKRMVAVALRNRWRRQQLEPAIRDEVAPKNIIMMGPTGVGKTEIARRLARLSSSPFLKVEATKFTEVGYVGRDVESMIRDLMEISVNLVREEERDSVKTRAEAAAEERLLDLLLPSSPAVNTSFDTPQTPAGGAENTRNKLRTLWREGRLDHREVEMEVEMQSGPQMDVMTMPGMEDIGSQFKDMFSKAFPPKRKRRRMKVGDAYAILLQEESERLIDHEKVIELARERAEQTGIIFLDEIDKIASSQQGGKTADISREGVQRDLLPIVEGSAVNTKYGIIHTDHILFIGAGAFHYSKPSDLIPELQGRFPLRVELTALGSKEFLRILTEPKNALTVQYKALLATEGVQIEYTEDALEAVADFAQEANQETENIGARRLYTIMEKILADLSFEAPDKSGERIVIDREYVRQHLADITANRDLTRYIL

hslU

ATP-dependent protease ATPase subunit HslU

448 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.676 kDa

MEIDKELTPKQIVEELNKYIVGQYEAKKAVAVALRNRWRRQKLPEDLRDEVIPKNILMIGPTGVGKTEIARRLANLVKAPFIKVEATKFTEVGYVGRDVESIIRELVDVSFKMVKAEKMEEVREKAKAIAEEKILDYLVPKKPKRYGTLIEEEEESPAREKFREMLKNGQLDDKVVEIDVEEKVSAVVGGVVVPGLEDIESQLKELFSNLGPSKRKKRRLTVKEALKIIENEEAEKLIDMDEVQTLAVKRAENLGIVFIDEIDKVAARGSSKSGPDVSREGVQRDLLPIVEGTVVSTKYGPVKTDHILFIAAGAFHLAKPSDLIPELQGRFPIRVELKALTKDDFVKILTEPKNALIKQYIALMSTEGVELEFTEDAIQEIAQIAEEVNERTENIGARRLHTILERIMEDYSFNAPDLKGQKIVIDSKLVREKLGNVITNEDLTRYIL

hslU

ATP-dependent protease ATPase subunit HslU

448 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.981 kDa

MNKLEEHYIVPKDVVAELDKYIIGQDEAKKLVSIALVNRYIRSRLPKEIKDEVMPKNIIMIGSTGIGKTEIARRLSKLIKAPFIKVEATKYTEVGYVGRDVESMVRDLMSIAVNMVKEEMYSTVRDDALVRTEERIVDSLFKGSSNSENMDPNEIKAEEKVKEKLRKKLRAGELDDTTIEIQISSKMPFSTIEIFTGGNFEEIDMGIGGLLGNIFDRKKKRELKIKKAKEIILAEELEKLVDHENISDIAKSKVENMGIIFIDEIDKIAAKNRSGNDVSREGVQRDILPIIEGSKVNTKYGIVDTSHILFIAAGAFNLAKPSDLIPELQGRFPIKVELKSLSIDDLKKILKQTKNSLIKQYVAMFKVYDLDLKFSEEAIDRIAELTFNMNLESENLGARRLHGVMEIVLADLFFEVPGSKLKKFEINLDYVNKKIQINEQKDLNYYII

hslU

ATP-dependent protease ATPase subunit HslU

448 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

51.514 kDa

MIISTEELTPQEIVERLDKYIIGQNKAKRSMAIAIRNRYRRQKLEEELKEEVIPKNILMIGPTGVGKTEIARRLAKLIKAPFIKIEVTKFTEVGYVGRNVESMVKDLVAESIQLVEEEKHEEVSKQARKQAENRIIDLLLSEKKSSSKGEQETDLRTRRREIKEQLFKGLLEDEYVTVKLEKEPAQDDNLMGEQFEEMGVNFKELFGKILPKESEHKKMTVKEARKVLTRQEADKLINKDQVNQEAIERAENYGIIFLDEFDKIAASSGKQSGGQDVSREGVQRDILPIVEGSTVNTRYGRVKTDHIMFIGAGAFHDSKPADLIPELQGRFPIRVELDSLTKDDFYRILTEPSNALLEQYKALLRTEEVKVNFTEDAIEELANMCEYVNENTEDIGARRLHTILETLLEELSFYAPEMKGQEVEINSNYVKDQLQDIVTEKDSSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

448 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.661 kDa

MTQMTPQEIVHELDQHIIGQHKAKRAVAIALRNRWRRQQVAEPLRSEITPKNILMIGPTGVGKTEIARRLAKLSGAPFIKVEATKFTEVGYVGRDVDTIIRDLVDVAIKDTREAAIKRNRTRAEDAAEERILDVLLPQPRKQPSGFFAEEPAVEEKHEDGATRQKFRKMLREGKFDDKEIELEIAAPAAQMNVMAPPGMEDFASQLQGMFQGLGAGKKQTAKMKVADAFKQLIDEEAAKLVNEEELKAEALKNVEQNGIVFIDEIDKVTSRGEGHSGADVSRAGVQRDLLPLVEGTTVSTKYGMVKTDHILFIASGAFQLSKPSDLIPELQGRLPIRVELSSLSVDDFKAILTSTNACLTRQYQALLATEGVELAFEDSGIQRLAEIAWQVNEKTENIGARRLYTVMEKLLEEVAFDAKSGACRIDGAYVDGKLGEVAEREDLARYVL

hslU

ATP-dependent protease ATPase subunit HslU

448 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.816 kDa

MSTMTPAEIVSELDKHIIGQGRAKKAVAVALRNRWRRQQVEDPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRETEMRKVRTKAEDQAEDRILDILLPSARPVGFGASSSAADTVDESSTTRQTFRKRLREGLLDDKEIELDVEQPQVGMDIMGPPGMEDMTEQIRSMFANIGGGKKTRRKLKVKEALKVLTDEEAGKMLNDEEVKTKAVQNVEQNGIVFLDEIDKIASRNEAGGGEVSRQGVQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVNDFESILVSTDASLVKQYQALLATEDVHLEFADDGIRRLAEIAYSVNEKTENIGARRLYTVIEKLLEEVSFAAGNHSGRTVQIDAAYVDRALNEVAEDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

448 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.772 kDa

MSTMTPAEIVSELDKHIIGQGRAKKAVAVALRNRWRRQQVEEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRETEMRKVRTKAEDQAEDRILDILLPSARPVGFGASSGAADTVDEGSTTRQTFRKRLREGLLDDKEVELDVEQPQVGMDIMGPPGMEDMTEQIRSMFANIGGGKKTRRKMKVKEALKALTDEEAARMLNDEEVKTKAVQNVEQNGIVFLDEIDKIASRNEAGGGEVSRQGVQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVNDFESILVSTDASLVKQYQALLATEDVHLEFADDGIRRLAEIAYAVNEKTENIGARRLYTVIEKLLEEVSFAAGNHSGRTVQIDAAYVDRALNEVAEDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

448 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.768 kDa

MQLREDLTPKQIVEELDKYIVGQKEAKKAVAIALRNRWRRHKLPEDLRDEVIPKNILMIGPTGVGKTEIARRLASLVGAPFIKVEATKFTEVGYVGRDVESIIRELAEASFKMVKAEKMEKVREKAKEIAEEKILDYLVPMRVKRYGTLETFEEETSPAREKFRQMLRNGELDERTVEIDVEEKGVSVVGGVIAPGLEDIENQLKDLFSSLAPTKRKRRKMTVREAMRVLEQQEAEKLIDMDEVASEAVYRAENFGIVFIDEIDKVAGKSTGSSPDVSREGVQRDLLPIVEGTTVSTKYGPVKTDHILFIAAGAFHLSKPSDLIPELQGRFPIRVELQPLTKDDFVKILTQPKNALIKQYKALMATEGVDIEFTDDAIEAIAEIAEQVNEKTENIGARRLHTILERIMEDYSFEAPDLKGQHIIIDEKVIRSKLGDIIQSEDLTRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.087 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLARLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAVKMLREQEIQKVKYRAEDAAEERILDALLPAARPAMGFGDEPAREDSNTRQLFRKRLREGQLDDKEIDIEVADNPAGVEIMAPPGMEEMTNQLQNLFSGMSKGKKKTRKLKVADALKMIRDEEAARLVNEEELKARALEAVEQHGIVFIDEIDKIAKRANAGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPNDFERILTEPHASLTEQYRELLKTEGLGIEFAEDGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAADLASEHSDKPIRIDAGYVNSHLGELAEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.082 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLARLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAVKMLREQEIQKVKYRAEDAAEERILDALLPAARPAMGFGDEPAREDSNTRQLFRKRLREGQLDDKEIDIEVADNPAGVEIMAPPGMEEMTNQLQNLFSGMSKGKKKTRKLKVAEALKLIRDEEAVRLVNEEELKARALEAVEQHGIVFIDEIDKIAKRANAGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPNDFERILTEPHASLTEQYRELLKTEGLAIEFAEDGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAADLASEHSDKPILIDAGYVNSHLGELAEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.082 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLARLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAVKMLREQEIQKVKYRAEDAAEERILDALLPAARPAMGFGDEPAREDSNTRQLFRKRLREGQLDDKEIDIEVADNPAGVEIMAPPGMEEMTNQLQNLFSGMSKGKKKTRKLKVAEALKLIRDEEAVRLVNEEELKARALEAVEQHGIVFIDEIDKIAKRANAGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPNDFERILTEPHASLTEQYRELLKTEGLAIEFAEDGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAADLASEHSDKPILIDAGYVNSHLGELAEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.082 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLARLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAVKMLREQEIQKVKYRAEDAAEERILDALLPAARPAMGFGDEPAREDSNTRQLFRKRLREGQLDDKEIDIEVADNPAGVEIMAPPGMEEMTNQLQNLFSGMSKGKKKTRKLKVAEALKLIRDEEAVRLVNEEELKARALEAVEQHGIVFIDEIDKIAKRANAGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPNDFERILTEPHASLTEQYRELLKTEGLAIEFAEDGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAADLASEHSDKPILIDAGYVNSHLGELAEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.149 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAALKMLREQEIVRVRHRAEDAAEDRILDALLPQARVSSFSEEAQQSSGDSNTRQLFRKRLREGQLDDKEIEIEVAESMGVDIAAPPGMEEMTNQLQSLFANMGKGKRKSRKLKVKEALKMVRDEEAGRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPEDFERILKEPHASLTEQYRELLKTEGLHIEFADEGLKRLAEIAFQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASTHDETPIHIDAAYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.982 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLADAALKMLREQEIIRVRHRAEDAAEDRILDALLPQARVTSFSEEAAQTSSDSNTRQLFRKRLREGQLDDKEIEIEVADAVGVEIAAPPGMEEMTNQLQSLFANMGKGKRKARKLKVKEALKMVRDEEASRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPEDFERILQEPHASLTEQYQALLKTEGLNIEFLADGIKRLAEIAYQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASTHDEAPIQIDAAYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.939 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLADAALKMLREQEIIRVRHRAEDAAEDRILDALLPQARVTSFSEEAAQTSSDSNTRQLFRKRLREGQLDDKEIEIEVADAVGVEIAAPPGMEEMTNQLQSLFANMGKGKRKARKLKVKEALKMVRDEEASRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPEDFERILQEPHASLTEQYQALLKTEGLNIAFQADGIKRLAEIAYQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASTHDEAPIQIDAAYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.982 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLADAALKMLREQEIIRVRHRAEDAAEDRILDALLPQARVTSFSEEAAQTSSDSNTRQLFRKRLREGQLDDKEIEIEVADAVGVEIAAPPGMEEMTNQLQSLFANMGKGKRKARKLKVKEALKMVRDEEASRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPEDFERILQEPHASLTEQYQALLKTEGLNIEFLADGIKRLAEIAYQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASTHDEAPIQIDAAYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.999 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLADAAMKMLREQEIIRVRHRAEDAAEDRILDALLPQARVTSFSEEAAQTSSDSNTRQLFRKRLREGQLDDKEIEIEVADAVGVEIAAPPGMEEMTNQLQSLFANMGKGKRKARKLKVKEALKMVRDEEASRLVNDDDLKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPEDFERILQEPHASLTEQYRELLKTEGLNIEFKADGIKRLAEIAYQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASAHDEAPIQIDAAYVNGHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.325 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRQEVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLADAALKMLREQEVHKMRHRAEDAAEERILDALLPPARPVGFSEEPVQSGDSNTRQLFRKRLREGQLDDKEIDIEVAESPAGVEIMAPPGMEEMTNQLQNLFANMGKGKKKSRKLKIKEAFKLIRDEEAARLVNEEDLKARALEAVEQNGIVFIDEIDKVAKRGNTSGADVSREGVQRDLLPLIEGSTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFERILTEPHAALTEQYRELLKTEGLHIEFLEDGIKRIAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAADLAGKQQGEPIRIDAAYVNEHLGELAQDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.087 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLARLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAVKMLREQEIQKVKYRAEDAAEERILDALLPAARPAMGFGDEPAREDSNTRQLFRKRLREGQLDDKEIDIEVADNPAGVEIMAPPGMEEMTNQLQNLFSGMSKGKKKTRKLKVADALKMIRDEEAARLVNEEELKARALEAVEQHGIVFIDEIDKIAKRANAGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPNDFERILTEPHASLTEQYRELLKTEGLGIEFAEDGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAADLASEHSDKPIRIDAGYVNSHLGELAEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.082 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLARLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAVKMLREQEIQKVKYRAEDAAEERILDALLPAARPAMGFGDEPAREDSNTRQLFRKRLREGQLDDKEIDIEVADNPAGVEIMAPPGMEEMTNQLQNLFSGMSKGKKKTRKLKVAEALKLIRDEEAVRLVNEEELKARALEAVEQHGIVFIDEIDKIAKRANAGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPNDFERILTEPHASLTEQYRELLKTEGLAIEFAEDGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAADLASEHSDKPILIDAGYVNSHLGELAEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.082 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLARLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAVKMLREQEIQKVKYRAEDAAEERILDALLPAARPAMGFGDEPAREDSNTRQLFRKRLREGQLDDKEIDIEVADNPAGVEIMAPPGMEEMTNQLQNLFSGMSKGKKKTRKLKVAEALKLIRDEEAVRLVNEEELKARALEAVEQHGIVFIDEIDKIAKRANAGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPNDFERILTEPHASLTEQYRELLKTEGLAIEFAEDGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAADLASEHSDKPILIDAGYVNSHLGELAEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.082 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLARLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAVKMLREQEIQKVKYRAEDAAEERILDALLPAARPAMGFGDEPAREDSNTRQLFRKRLREGQLDDKEIDIEVADNPAGVEIMAPPGMEEMTNQLQNLFSGMSKGKKKTRKLKVAEALKLIRDEEAVRLVNEEELKARALEAVEQHGIVFIDEIDKIAKRANAGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPNDFERILTEPHASLTEQYRELLKTEGLAIEFAEDGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAADLASEHSDKPILIDAGYVNSHLGELAEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.149 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAALKMLREQEIVRVRHRAEDAAEDRILDALLPQARVSSFSEEAQQSSGDSNTRQLFRKRLREGQLDDKEIEIEVAESMGVDIAAPPGMEEMTNQLQSLFANMGKGKRKSRKLKVKEALKMVRDEEAGRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPEDFERILKEPHASLTEQYRELLKTEGLHIEFADEGLKRLAEIAFQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASTHDETPIHIDAAYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.982 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLADAALKMLREQEIIRVRHRAEDAAEDRILDALLPQARVTSFSEEAAQTSSDSNTRQLFRKRLREGQLDDKEIEIEVADAVGVEIAAPPGMEEMTNQLQSLFANMGKGKRKARKLKVKEALKMVRDEEASRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPEDFERILQEPHASLTEQYQALLKTEGLNIEFLADGIKRLAEIAYQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASTHDEAPIQIDAAYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.939 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLADAALKMLREQEIIRVRHRAEDAAEDRILDALLPQARVTSFSEEAAQTSSDSNTRQLFRKRLREGQLDDKEIEIEVADAVGVEIAAPPGMEEMTNQLQSLFANMGKGKRKARKLKVKEALKMVRDEEASRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPEDFERILQEPHASLTEQYQALLKTEGLNIAFQADGIKRLAEIAYQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASTHDEAPIQIDAAYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.982 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLADAALKMLREQEIIRVRHRAEDAAEDRILDALLPQARVTSFSEEAAQTSSDSNTRQLFRKRLREGQLDDKEIEIEVADAVGVEIAAPPGMEEMTNQLQSLFANMGKGKRKARKLKVKEALKMVRDEEASRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPEDFERILQEPHASLTEQYQALLKTEGLNIEFLADGIKRLAEIAYQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASTHDEAPIQIDAAYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.999 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLADAAMKMLREQEIIRVRHRAEDAAEDRILDALLPQARVTSFSEEAAQTSSDSNTRQLFRKRLREGQLDDKEIEIEVADAVGVEIAAPPGMEEMTNQLQSLFANMGKGKRKARKLKVKEALKMVRDEEASRLVNDDDLKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPEDFERILQEPHASLTEQYRELLKTEGLNIEFKADGIKRLAEIAYQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASAHDEAPIQIDAAYVNGHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.325 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRQEVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLADAALKMLREQEVHKMRHRAEDAAEERILDALLPPARPVGFSEEPVQSGDSNTRQLFRKRLREGQLDDKEIDIEVAESPAGVEIMAPPGMEEMTNQLQNLFANMGKGKKKSRKLKIKEAFKLIRDEEAARLVNEEDLKARALEAVEQNGIVFIDEIDKVAKRGNTSGADVSREGVQRDLLPLIEGSTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFERILTEPHAALTEQYRELLKTEGLHIEFLEDGIKRIAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAADLAGKQQGEPIRIDAAYVNEHLGELAQDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.096 kDa

MTMTPREIVAELDKFIIGQNDAKRAVAIALRNRWRRMQLGEELRREIFPKNILMIGPTGVGKTEIARRLSDLAGAPFLKIEATKFTEVGYVGRDVESIIRDLVDVAVKMTREKAIRQVKSLAEEAAEERVLDALIPPARGGFQGEPTAEEKPTEKKESATRQLFRKKLRNGGLDDKEIEVEVSAHPSFEIMGPPGMEEMVSQLQGIMSSMSSRRSKSRRLKVKDALRILGEEEAAKLVDEDQIKSTALASVEQNGIVFIDEIDKIVKRDGAVGADVSREGVQRDLLPLVEGSTVFTKYGMVKTDHILFIASGAFHIAKPSDLVPELQGRFPIRVELKALTADDFVRILTEPKASLTEQYTELLKTENFGLSFTKDGIKRLAEIAYQVNDRSENIGARRLHTIMERLLEEVSFEATDKQGESITIDADYVNKQLKKLAEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.182 kDa

MTMTPREIVAELDKFIIGQNDAKRAVAIALRNRWRRMQLGEELRREIFPKNILMIGPTGVGKTEIARRLSDLAGAPFLKIEATKFTEVGYVGRDVESIIRDLVDVAVKMTREKAIRQVKSLAEEAAEERVLDALIPPARGGFQGEPTAEEKPTEKKESATRQLFRKKLRNGELDDKEIEVEVSAHPSFEIMGPPGMEEMVSQLQGIMSSMSSRRSKSRRLKVKDALRILGEEEAAKLVDEDQIKSTALASVEQNGIVFIDEIDKIVKREGAVGADVSREGVQRDLLPLVEGSTVFTKYGMVKTDHILFIASGAFHIAKPSDLVPELQGRFPIRVELKALTADDFVRILTEPKASLTEQYTELLKTENFGLSFTKDGIKRLAEIAYQVNDRSENIGARRLHTIMERLLEEVSFEATDKQGESITIDADYVNKQLKKLAEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.182 kDa

MTMTPREIVAELDKFIIGQNDAKRAVAIALRNRWRRMQLGEELRREIFPKNILMIGPTGVGKTEIARRLSDLAGAPFLKIEATKFTEVGYVGRDVESIIRDLVDVAVKMTREKAIRQVKSLAEEAAEERVLDALIPPARGGFQGEPTAEEKPTEKKESATRQLFRKKLRNGELDDKEIEVEVSAHPSFEIMGPPGMEEMVSQLQGIMSSMSSRRSKSRRLKVKDALRILGEEEAAKLVDEDQIKSTALASVEQNGIVFIDEIDKIVKREGAVGADVSREGVQRDLLPLVEGSTVFTKYGMVKTDHILFIASGAFHIAKPSDLVPELQGRFPIRVELKALTADDFVRILTEPKASLTEQYTELLKTENFGLSFTKDGIKRLAEIAYQVNDRSENIGARRLHTIMERLLEEVSFEATDKQGESITIDADYVNKQLKKLAEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.685 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVGEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFVKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTREAEMRKVRSKATDQAEDRILDILLPQPRAVGFGGNADHANDDNNATRQTFRKRLREGQLDDKEVELDLEQPSAGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIKEALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNNEGSGGEVSRQGVQRDLLPLVEGTTVNTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVEDFEAILDATDASLVKQYQALLATEDVQLEFAADGIRRLAEIAYSVNEKTENIGARRLYTVIEKLLEEVSFSAGNHAGECVTIDATYVDRALGEVAQDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.818 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTREAEMRKVRSKATDQAEDRILDILLPQPRAVGFGGNAEHANDDNNATRQTFRKRLREGQLDDKEVELDLEQPSVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIKEALKLLTDEEAAKMLNEEEVKTKAVQNVEQNGIVFLDEIDKITSRNNEGSGGEVSRQGVQRDLLPLVEGTTVNTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVEDFEAILDATDASLVKQYQALLATEDVQLEFAADGIRRLAEIAFAVNEKTENIGARRLYTVIEKLLEEVSFSAGNHAGERVTIDAKYVDRALGEVAQDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.818 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTREAEMRKVRSKATDQAEDRILDILLPQPRAVGFGGNAEHANDDNNATRQTFRKRLREGQLDDKEVELDLEQPSVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIKEALKLLTDEEAAKMLNEEEVKTKAVQNVEQNGIVFLDEIDKITSRNNEGSGGEVSRQGVQRDLLPLVEGTTVNTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVEDFEAILDATDASLVKQYQALLATEDVQLEFAADGIRRLAEIAFAVNEKTENIGARRLYTVIEKLLEEVSFSAGNHAGERVTIDAKYVDRALGEVAQDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.818 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTREAEMRKVRSKATDQAEDRILDILLPQPRAVGFGGNAEHANDDNNATRQTFRKRLREGQLDDKEVELDLEQPSVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIKEALKLLTDEEAAKMLNEEEVKTKAVQNVEQNGIVFLDEIDKITSRNNEGSGGEVSRQGVQRDLLPLVEGTTVNTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVEDFEAILDATDASLVKQYQALLATEDVQLEFAADGIRRLAEIAFAVNEKTENIGARRLYTVIEKLLEEVSFSAGNHAGERVTIDAKYVDRALGEVAQDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.833 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVADPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTREAEMRKVRSKATDQAEDRILDILLPQPRAVGFGGNAEHANDDNNATRQTFRKRLREGQLDDKEVELDLEQPSVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIKEALKLLTDEEAAKMLNEEEVKTKAVQNVEQNGIVFLDEIDKITSRNNEGSGGEVSRQGVQRDLLPLVEGTTVNTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVNDFEAILVATDASLVKQYQALLATEDVQLEFADDGIRRLAEIAFAVNEKTENIGARRLYTVIEKLLEEVSFSAGNHAGERVTIDAKYVDRALGEVSQDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.761 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVGEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFVKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTREAEMRKVRTKATDQAEDRILDVLLPQPRAVGFGGNADHANDDNNATRQTFRKRLREGQLDDKEVELDLEQPSAGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIKEALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNNEGSGGEVSRQGVQRDLLPLVEGTTVNTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVEDFEAILDATDASLVKQYQALLATEDVQLEFAADGIRRLAEIAYAVNEKTENIGARRLYTVIEKLLEEVSFSAGNHAGERVTIDAKYVEHALGEVSQDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.853 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVADPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRETEMRKVRSKATDQAEDRILDILLPQPRAVGFGGNAEHANDDNNATRQTFRKRLREGQLDDKEVELDIEQPSAGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIKEALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNNEGSGGEVSRQGVQRDLLPLVEGTTVNTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVNDFEAILVATDASLVKQYQALLATEDVQLEFADDGIRRLAEIAYSVNEKTENIGARRLYTVIEKLLEEVSFSAGNHAGERVTIDAKYVDRALGEVSQDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.757 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRETEMRKVRSKATDLAEDRILDVLLPQPRAVGFGASAEHANDDNNATRQTFRKRLREGQLDDKEIELDIEQPAVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIREALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNHEGGGGEVSRQGVQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVKDFEAILVATDASLVKQYQALLATEDVKLEFADDGIRRLAEIAYAVNEKTENIGARRLYTVIEKLLEEVSFAAGNHAGQSVTIDSAYVDRALGEVSKDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.757 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRETEMRKVRSKATDLAEDRILDVLLPQPRAVGFGASAEHANDDNNATRQTFRKRLREGQLDDKEIELDIEQPAVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIREALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNHEGGGGEVSRQGVQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVKDFEAILVATDASLVKQYQALLATEDVKLEFADDGIRRLAEIAYAVNEKTENIGARRLYTVIEKLLEEVSFAAGNHAGQSVTIDSAYVDRALGEVSKDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.757 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRETEMRKVRSKATDLAEDRILDVLLPQPRAVGFGASAEHANDDNNATRQTFRKRLREGQLDDKEIELDIEQPAVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIREALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNHEGGGGEVSRQGVQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVKDFEAILVATDASLVKQYQALLATEDVKLEFADDGIRRLAEIAYAVNEKTENIGARRLYTVIEKLLEEVSFAAGNHAGQSVTIDSAYVDRALGEVSKDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.757 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRETEMRKVRSKATDLAEDRILDVLLPQPRAVGFGASAEHANDDNNATRQTFRKRLREGQLDDKEIELDIEQPAVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIREALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNHEGGGGEVSRQGVQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVKDFEAILVATDASLVKQYQALLATEDVKLEFADDGIRRLAEIAYAVNEKTENIGARRLYTVIEKLLEEVSFAAGNHAGQSVTIDSAYVDRALGEVSKDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.757 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRETEMRKVRSKATDLAEDRILDVLLPQPRAVGFGASAEHANDDNNATRQTFRKRLREGQLDDKEIELDIEQPAVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIREALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNHEGGGGEVSRQGVQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVKDFEAILVATDASLVKQYQALLATEDVKLEFADDGIRRLAEIAYAVNEKTENIGARRLYTVIEKLLEEVSFAAGNHAGQSVTIDSAYVDRALGEVSKDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.71 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRETEMRKVRSKATDLAEDRILDVLLPQPRAVGFGASAEHANDDNNATRQTFRKRLREGQLDDKEIELDIEQPAVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIKEALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNHEGGGGEVSRQGVQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVKDFEAILVATDASLVKQYQALLATEDVKLEFADDGIRRLAEIAYAVNEKTENIGARRLYTVIEKLLEEVSFAAGNHAGQSVTIDSAYVDHALGEVSKDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.757 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRETEMRKVRSKATDLAEDRILDVLLPQPRAVGFGASAEHANDDNNATRQTFRKRLREGQLDDKEIELDIEQPAVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIREALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNHEGGGGEVSRQGVQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVKDFEAILVATDASLVKQYQALLATEDVKLEFADDGIRRLAEIAYAVNEKTENIGARRLYTVIEKLLEEVSFAAGNHAGQSVTIDSAYVDRALGEVSKDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.71 kDa

MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRETEMRKVRSKATDLAEDRILDVLLPQPRAVGFGASAEHANDDNNATRQTFRKRLREGQLDDKEIELDIEQPAVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIKEALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNHEGGGGEVSRQGVQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVKDFEAILVATDASLVKQYQALLATEDVKLEFADDGIRRLAEIAYAVNEKTENIGARRLYTVIEKLLEEVSFAAGNHAGQSVTIDSAYVDHALGEVSKDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.758 kDa

MSTMTPAEIVSELDKHIIGQDKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRETEMRKVRSKATDLAEDRILDVLLPQPRAVGFGASVEHANDDNNATRQTFRKRLREGQLDDKEIELDIEQPTVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIKEALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNHEGGGGEVSRQGVQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVKDFEAILVATDASLVKQYQALLATEDVALEFADDGIRRLAEIAYAVNEKTENIGARRLYTVIEKLLEEVSFAAGNHAGQSVTIDAAYVDRALGEVSKDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.856 kDa

MSTMTPAEIVSELDKHIIGQSKAKKAVAVALRNRWRRQQVTEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRESEMRKVRSKATDQAEDRILDILLPQPRAVGFGGNADHANDDNNATRQTFRKRLREGQLDDKEIELDLEQPSAGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIQEALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNNEGSGGEVSRQGVQRDLLPLVEGTTVNTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVEDFESILVATDASLVKQYQALLATEDVQLDFAADGIRRLAEIAYAVNEKTENIGARRLYTVIEKLLEEVSFSAGNHAGERVTIDAQYVDRALGEVSQDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

447 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.682 kDa

MSTMTPAEIVSELDKHIIGQNRAKKAVAVALRNRWRRQQVDEPLRQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLIEISVKQTRETEMRKMRTKAEDLAEDRILDILLPGARTVGFGSGTSEASGDESNTTRQTFRKRLREGALDDKEIELDIEMQAPAMDIMGPPGMEDMTEQIRSMFANLGGGKKTRRKVKVKEALKLLTDEEASKMLNDEEVKTKAVQNVEQNGIVFLDEIDKIASRSEAGGGEVSRQGVQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVKDFESILVATDASLVKQYQALLATEDVHLEFADDGIRRLAEIAFSVNEKTENIGARRLYTVIEKLLEEVSFSAGNHTGKSVLIDAAYVDRALNDVAQDEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

446 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.056 kDa

MSMTPREIVHELNRHIVGQEDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARRLARLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAVKMMREQEIQRVRHRAEDAAEDRILDALLPPARQGFGDEPIAREDSNTRQLFRKRLREGQLDDKEIDIEITETPSGVEIMAPPGMEEMTSQLQNLFSSMGKGRKKTHKLKVKDALKLVRDEEAARLVNEEELKARALESVEQNGIVFIDEIDKVAKRANVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLAKPSDLVPELQGRLPIRVELKALTPEDFERILTEPHASLTEQYRELLKTEGLNIQFAADGIKRIAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLAADHSGQPIVIDAAYVNNHLGELAQDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

446 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.046 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAIKMFREQEMIRVRHRAEDAAEERILDALLPQARTGFNSDDAAPAQDSNTRQLFRKRLREGQLDDKEIEIEVAEAAGVDISAPPGMEEMTNQLQSLFANMGKGKRKNRKLKVKEALKLVRDEEASRLVNDEELKAKALEAVEQHGIVFIDEIDKVAKRGNAGGVDVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFERILSEPHASLTEQYRELLKTEGLNIEFLPEGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASAHSEEPIRIDAAYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

446 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.819 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPADLRQEVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLADAAVKMLREQEMTKVRHRAEDAAEERILDALLPPARQAFGDEPVRSEDSNTRQLFRKRLREGQLDDKEIDIEVAESPMGVEIMTPPGMEEMTSQLQNLFAGLGKGKKKSRKLKVADALKLVRDEEAARLVNEEELKARALEAVEQHGIVFIDEIDKVAKRGNTGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLAKPSDLVPELQGRLPIRVELKALSPQDFERILTEPHASLTEQYAALLKTEGLNIEFAEEGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLAGQQSGEPIRIDAAYVNGHLGELAQDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

446 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.046 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAIKMFREQEMIRVRHRAEDAAEERILDALLPQARTGFNSDDAAPAQDSNTRQLFRKRLREGQLDDKEIEIEVAEAAGVDISAPPGMEEMTNQLQSLFANMGKGKRKNRKLKVKEALKLVRDEEASRLVNDEELKAKALEAVEQHGIVFIDEIDKVAKRGNAGGVDVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFERILSEPHASLTEQYRELLKTEGLNIEFLPEGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASAHSEEPIRIDAAYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

446 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.819 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPADLRQEVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLADAAVKMLREQEMTKVRHRAEDAAEERILDALLPPARQAFGDEPVRSEDSNTRQLFRKRLREGQLDDKEIDIEVAESPMGVEIMTPPGMEEMTSQLQNLFAGLGKGKKKSRKLKVADALKLVRDEEAARLVNEEELKARALEAVEQHGIVFIDEIDKVAKRGNTGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLAKPSDLVPELQGRLPIRVELKALSPQDFERILTEPHASLTEQYAALLKTEGLNIEFAEEGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLAGQQSGEPIRIDAAYVNGHLGELAQDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

446 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.707 kDa

MTTMTPQEIVSELDKHIVGQKNAKKAVAIALRNRWRRSQVAEPLRQEITPKNILMIGPTGVGKTEIARRLARLANAPFIKIEATKFTEVGYVGRDVETIIRDLVEMAIKSHRERAMKAMRARAEDAAEERILDVLLPTVRGPNFFAENSESTAAENTTRQKFRKKLREGELDDKEVDIEVAAPSLQAEIFAPPGMEELTQQIQGMFQSVGGGKKKSRKLSIKEALKLLTDEEAAKLVNDDDVKQEAVKAVEQNGIVFLDELDKIASRSEMHGADVSRQGVQRDLLPLVEGTTVSTKYGMIKTDHILFIASGAFHLSKPSDLIPELQGRFPIRVELDSLSVADFECILTQTDACLTRQYQALLETEGVQLEFVEDGIRRLAEIAFQVNEKTENIGARRLHTVMEKLLEEVSFDAGKVGLDKVLIDAAYVNTKLGELAADEDLSRYVL

hslU

ATP-dependent protease ATPase subunit HslU

446 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.598 kDa

MSSMTPQEIVSELDRHIVGQNGAKRAVAIALRNRWRRQQVDASLRHEITPKNILMIGPTGVGKTEIARRLARLADAPFIKVEATKFTEVGYVGKDVDSIVRDLVEVAVKQTREADMKKVRVRAEDAAEDRILDVLIPPARGASVDTARTGDPAGDSTARQVFRKKLREGQLDDKEIEIDLADARPQFEIMSPAGMEEMTEQLRGMFSQMGQERRRARKLKIAEAMKLLVEEEAAKLVNEEEVKTRALANAEQNGIVFIDEIDKVASRQEAGGADVSRQGVQRDLLPLVEGTTVSTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELTSLSVQDFEAILTQTHASLVKQYQALLETEGVTLDFTPEGITRLAHIAFEVNERTENIGARRLSTVMERLLDEVSYDATRLSGQTVVVDAGYVNARLQSLSQDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

446 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.582 kDa

MSSMTPQEIVSELDRHIVGQNGAKRAVAIALRNRWRRQQVDASLRHEITPKNILMIGPTGVGKTEIARRLARLADAPFIKVEATKFTEVGYVGKDVDSIVRDLVEVAVKQTREADMKKVRVRAEDAAEDRILDVLIPPARGAGVDTARTGEPAGDSTARQVFRKKLREGQLDDKEIEIDLADARPQFEIMSPAGMEEMTEQLRGMFSQMGQERRRARKLKIAEAMKLLVEEEAAKLVNEEEVKTRALANAEQNGIVFIDEIDKVASRQEAGGADVSRQGVQRDLLPLVEGTTVSTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELTSLSVQDFEAILTQTHASLVKQYQALLETEGVTLDFTPEGITRLAHIAFEVNERTENIGARRLSTVMERLLDEVSYDATRLSGQTVVVDAGYVNARLQSLSQDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

446 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.003 kDa

MSEMTPREIASELDRFIIGQDKAKRAVAIALRNRWRRMQLDEALRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAVKMVRSQAIEKNRYRAEEMAEERILDVLIPPAKNNWGVTESASSSEPSAARQAFRKKLREGQLDDKEIEIELAATPMGVEIMAPPGMEEMTNQLQSMFQNLAGQKQKARKMKIKEAFKLIVEEEAAKLVNPEELKQQAIDAVEQHGIVFIDEVDKICKRGGQSSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELQALTAEDFERILTEPNASLTKQYQALMATEGVSINFSQDGIRKIAESAWRVNETTENIGARRLHTVLERLMEEISYDASERQGETILIDAEYVKQHLDELVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

446 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.404 kDa

MSHMTPSEIVNELDDYIIGQHNAKRAVAIALRNRWRRMQLDETLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRLQSMEKNRFRAEERAEERILDVLIPQPTPNNWDKIEENNSSEPSSTRQHFRKKLREGQLNEKEIEINLAATPIGVEIMAPPGMEEMTNQLQSMFKNLAGQKQKSRKMKIKEAMKLLIEEEAAKLVNQEKIKEKAIEAVEQNGIVFIDEIDKICKRGDVSGPDVSSEGVQRDLLPLVEGCTVSTKHGMVKTDYILFIASGAFQVASPSDLIPELQGRLPIRVELEALTPKDFQLILTEPNASLTMQYIALMATEGVSISFTEDGIKRIAETAWQVNERTENIGARRLHTILELLMEDISYDASEWHGKTISIDADYVRSHLDDLVSDEDFSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

446 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.225 kDa

MSEMTPREIVHELNRHIIGQDNAKRSVAIALRNRWRRMQLEESLRVEVSPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVETIIRDLTDVAIKMTHQQAMEKVQYRAEEQAEERILDALLPPARDAWGQNEQSTEDTTSSNTRQIFRKKLREGKLDDKEIEVDVAAPQMGVEIMSPPGMEEMTNQLQGMFQNLAGDTKKKRKMKIKDAFKALTEEEAAKLVNQEELKESAIFNAENNGIVFIDEIDKICKRGDSSGPDVSREGVQRDLLPLIEGSTVSTKHGMVKTDHILFITSGAFQVAKPSDLIPELQGRLPIRVELEALSAHDFKRILTEPKASLTEQYIALMKTEDVGIEFTEDGINQIADAAWRVNETTENIGARRLHTVMERLMDEISFDATDRAGSKLVIDEAYVISKLGELVEDEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

445 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.855 kDa

MASLTPKDIVSELNRHIVGQDAAKRAVALALRTRWRRMQLPEEMRAEVAPKNILMIGPTGVGKTEIARRLAKLADAPFIKVEATKFTEVGYVGRDVESIIRDLMEVAIKLLRDKEIARVGSQADDAAEERILDALLPPARTDDSSANTDNSTRQIFRKKLREGELDDKEIDVDVASNPAGIDIMAPPGMEEMTSQLQQMFSKMGNNQQRKSQKLKVREAYRLIRDEEAARFVNEDELKVQAIDAVENSGIVFIDEIDKVAKRGEGGGTDVSREGVQRDLLPLIEGSTVSTKYGMVKTDHILFIASGAFHLSRPSDLIPELQGRLPIRVELSPLSPDDFQRILTEPKCSLTEQYKALLETEGLNLEITDDCIRRIAEVAWQVNERTENIGARRLHTVLEKLLEEISFDADSLATQYHDKPLVLDAEAVDRYLGELADDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

445 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.991 kDa

MENLTPKKIVEELDKFIIGQESAKKAVAIALRNRFRRQLLPKELRDEILPKNILMIGPTGVGKTEIARRLARLVNAPFVKVEASKFTEVGYVGRDVESIIRDLTEVAMNMVKQEHTERVQEKARQLAEERVLDILLPQPRYTRDMNEAEERTRYKETREKLRKQLREGILDERYIEIDLKEKVVPFGIISNVAMEEIEINLKEMLGSFLPEKVKRKKVKIPEAIQLFTQEEANKLIDMEKVTKEAIERVEQTGIVFIDEIDKIASRGSSYGPDVSREGVQRDLLPIVEGSTVTTKYGPVKTDHILFIAAGAFHVAKPSDLIPELQGRFPIRVELNSLGKEEFVRILTEPDNALIKQYIALLATEDVYLEFTQDGIEEIADISQQVNEKTENIGARRLHTVMEKLLEDISFNASELKGQKITIDAKFVREKLSEIIKSEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

445 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.935 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLHEELRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAIKLLREQEIIKVRHRAEDAAEDRILDALLPPARVGFNEDPAQSNDSNTRQLFRKRLREGQLDDKEIEIEINEAVGVDISAPPGMEEMTNQLQSLFANMGKGKTKSRKLKVKDALKLVREEEAGRLVNDEELKAKALEAVEQHGIVFIDEIDKVAKRGNSGGVDVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFERILSEPHASLTEQYRELLKTEGLKIEFKPEGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLAISPDAAPIEIDAEYVNSHLGDLAENEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

445 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.638 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAALKLLREQEMTKVSHRAEDAAEERILDALLPPARMGFNEDAAPASDSNTRQLFRKRLREGQLDDKEIEIEVAEVSGVDISAPPGMEEMTSQLQNLFANMGKGKKKSRKLKVKEALKLVRDEEAGRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNSGGVDVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPGDFERILSEPHASLTEQYRELLKTEGLGIEFQPDGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLAGAQNGEVIKIDADYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

445 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.992 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAIKMLREQEMTRVRHRAEDAAEDRILDALLPPARMGFSNEEAPTQDSNTRQLFRKRLREGQLDDKEIEIEVAEMAGIEIATPPGMEEMTNQLQNLFANMGKGKKKARKLKVKEALKLVRDEEAGRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFERILSEPHASLTEQYCALLKTEGLNIQFQPEGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASAHDDKAIQIDAEYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

445 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.909 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAIKLLREQEIVKVRHRAEDAAEDRILDALLPPARVGFNEDPAQSNDSNTRQLFRKRLREGQLDDKEIEIEINEAVGVDISAPPGMEEMTNQLQSLFANMGKGKTKSRKLKVKEALKLVREEEAGRLVNDEELKVKALEAVEQHGIVFIDEIDKVAKRGNSGGVDVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFERILTEPHASLTEQYRELLKTEGLKIEFKPDGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLAISPDAAPIEIDADYVNSHLGDLAENEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

445 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.896 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAIKLLREQEIVKVRHRAEDAAEERILDALLPPARVGFNEDPAQSSDSNTRQLFRKRLREGQLDDKEIEIEINEAVGVDISAPPGMEEMTNQLQSLFANMGKGKTKSRKLKVKEALKLVREEEAGRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNSGGVDVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFERILSEPHASLTEQYRELLKTEGLKIEFKPEGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLAISPDAAPIEIDAEYVNSHLGDLAENEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

445 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.935 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLHEELRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAIKLLREQEIIKVRHRAEDAAEDRILDALLPPARVGFNEDPAQSNDSNTRQLFRKRLREGQLDDKEIEIEINEAVGVDISAPPGMEEMTNQLQSLFANMGKGKTKSRKLKVKDALKLVREEEAGRLVNDEELKAKALEAVEQHGIVFIDEIDKVAKRGNSGGVDVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFERILSEPHASLTEQYRELLKTEGLKIEFKPEGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLAISPDAAPIEIDAEYVNSHLGDLAENEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

445 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.638 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAALKLLREQEMTKVSHRAEDAAEERILDALLPPARMGFNEDAAPASDSNTRQLFRKRLREGQLDDKEIEIEVAEVSGVDISAPPGMEEMTSQLQNLFANMGKGKKKSRKLKVKEALKLVRDEEAGRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNSGGVDVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPGDFERILSEPHASLTEQYRELLKTEGLGIEFQPDGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLAGAQNGEVIKIDADYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

445 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.992 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAIKMLREQEMTRVRHRAEDAAEDRILDALLPPARMGFSNEEAPTQDSNTRQLFRKRLREGQLDDKEIEIEVAEMAGIEIATPPGMEEMTNQLQNLFANMGKGKKKARKLKVKEALKLVRDEEAGRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFERILSEPHASLTEQYCALLKTEGLNIQFQPEGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLASAHDDKAIQIDAEYVNSHLGELAQNEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

445 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.909 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAIKLLREQEIVKVRHRAEDAAEDRILDALLPPARVGFNEDPAQSNDSNTRQLFRKRLREGQLDDKEIEIEINEAVGVDISAPPGMEEMTNQLQSLFANMGKGKTKSRKLKVKEALKLVREEEAGRLVNDEELKVKALEAVEQHGIVFIDEIDKVAKRGNSGGVDVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFERILTEPHASLTEQYRELLKTEGLKIEFKPDGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLAISPDAAPIEIDADYVNSHLGDLAENEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

445 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.896 kDa

MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAIKLLREQEIVKVRHRAEDAAEERILDALLPPARVGFNEDPAQSSDSNTRQLFRKRLREGQLDDKEIEIEINEAVGVDISAPPGMEEMTNQLQSLFANMGKGKTKSRKLKVKEALKLVREEEAGRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNSGGVDVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFERILSEPHASLTEQYRELLKTEGLKIEFKPEGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLAISPDAAPIEIDAEYVNSHLGDLAENEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

445 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.704 kDa

MTNFTPREIVSELDRYIIGQKQAKRAVAVALRNRWRRQQVADELRDEIAPKNIIMIGPTGVGKTEIARRLARLAQAPFIKVEASKFTEVGYVGRDVESMVRDLLDLAIIMIREEEARKVRVKAEDLAEERLLDLLLPGAQSRDPDLSGEEAGEGGTRDKLRKLLRKGALDERKVELEVQAAQMPMMEVFTPQGTEEMGINFKEMFGNLFPKKTKRRQIKVSEAREILIEQEAERLVDMEKVNTLARERVEQSGIIFIDEIDKIAGQNGRQGPDVSREGVQRDILPIVEGSTVSTKYGPVKTDHILFVAAGAFHVAKPSDLIPELQGRFPIRVELTSLGEEEFFRILTEPKNALIRQYEALMETEGIRLHFTEEAIREIARIATQVNSQTENIGARRLHTIMEKLLEELSFEAPEHREQSVEIDVDYVRKQLSDIARDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.596 kDa

MSEMTPREIVHELDSHIIGQDKAKRSVAIALRNRWRRMQLAPELRTEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVESIIRDLTDVAIKMTHQQAVEKVKFRAEEHAEDRILDILLPPARDAWGNNEEGNNDSGTRQSFRKKLREGKLDDKEIEVDVAAPQVGVEIMAPPGMEEMTNQLQGMFQNLSGGNTTKKRKMKIVDALKALTEEEGAKLVNPEELKEQAIFNVENHGIVFIDEIDKICKGSNSHSGDVSREGVQRDLLPLVEGSTVSTKHGMVKTDHMLFITSGAFQMAKPSDLIPELQGRLPIRVELEALTADDFKRILTEPNASLTEQYIALLATENVKVEFTEDGISRIAESAFQVNETTENIGARRLHTVMERLMEEISYDASEKNGESLIVDAEYVSSRLGELVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.596 kDa

MSEMTPREIVHELDSHIIGQDKAKRSVAIALRNRWRRMQLAPELRTEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVESIIRDLTDVAIKMTHQQAVEKVKFRAEEHAEDRILDILLPPARDAWGNNEEGDNDSGTRQSFRKKLREGKLDDKEIEVDVAAPQVGVEIMAPPGMEEMTNQLQGMFQNLSGGNTTKKRKMKIVDALKALTEEEGAKLVNPEELKEQAIFNVENHGIVFIDEIDKICKGSNSHSGDVSREGVQRDLLPLVEGSTVSTKHGMVKTDHMLFITSGAFQMAKPSDLIPELQGRLPIRVELEALTANDFKRILTEPNASLTEQYIALLATENVKVEFTEDGISRIAESAFQVNETTENIGARRLHTVMERLMEEISYDASEKNGESLIVDAEYVSSRLGELVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.65 kDa

MSEMTPREIVHELDSHIIGQDKAKRSVAIALRNRWRRMQLQPELRAEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDVAIKMTHQQAVEKVKFRAEEQAEDRILDILLPPARDAWGKNEEGDNDSGTRQSFRKKLREGKLDDKEIDVDVAAPQVGVEIMAPPGMEEMTNQLQGMFQNLSGGETTKKRKMKIKDALKALAEEEGAKLVNPEELKEQAIFNVENHGIVFIDEIDKICKGSNSQSGDVSREGVQRDLLPLVEGSTVSTKHGMVRTDHMLFITSGAFQMAKPSDLIPELQGRLPIRVELEALTANDFKRILTEPNASLTEQYIALLATENVNIEFTEDGISRIAESAFRVNETTENIGARRLHTVMERLMEEISYDASEKGGDSLTVDDAYVTSRLGELIENEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.863 kDa

MSDMTPREIVQELDKHIVGQKDAKRAVAIALRNRWRRQQLPEALRQEVTPKNILMIGPTGVGKTEIARRLARLANAPFIKVEATKFTEVGYVGRDVESIIRDLVDAAIKLLREQEMGKVRFRAEEAAEERVLDVLLPAPRQAGFMSEPASAPEQSETRQKFRKRLREGQLDDKEIEIQVSATPVGVEIMTPPGMEEMASQLQSLFQNIGGGRSQTRKLKIRDAMKLLTDEEAARMVNQDELKLRAVANVEQNGIVFLDEIDKVAKRGEYGGADVSREGVQRDLLPLVEGCTVNTKFGMVRTDHILFIASGAFHLSKPSDLIPELQGRLPIRVELSALTAEDFVRILTEPDASLTEQYSALLQTEGVEVNFAEDGVRRIAEIATRVNERTENIGARRLHTVMERLLEQISFEAPDHQGPVSIDAAYVDERLEELVQDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.744 kDa

MSANHMTPDEIVAELDKFIIGQNRAKRAVAVALRNRWRRQQVAEPLRHEIHPKNILMIGPTGVGKTEIARRLAKLANAPFIKIEATKFTEVGYVGRDVDTIIRDLTEYSIKQTRELEMRRVRSHAEDAAEDRILDALVPPPRGASGEPERGEDNSARQTFRKRLREGKIDDLEIEIEIAQPMPQMDVMTPPGMEEMAEQLRGMFAGLARDKKKSKKIKVREAFKLIVEEEAAKRVNEDDLRAAAITNVEQNGIVFLDEIDKIAARQETGGADVSRQGVQRDLLPLVEGTTVNTRYGMVRTDHILFIASGAFHLARPSDLIPELQGRFPIRVELDSLSAEDFVSILSETDASLIKQYTALLGTEDVKLEFTDDGIRRLAELAFSVNERTENIGARRLYTVMEKLLEELSFDASANSGEVITIDAAYVDLQLAETAGSQDLARYVL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.71 kDa

MSASTMTPGEIVSELDKYIIGQNRAKRAVAVALRNRWRRQQVEEPLRHEIHPKNILMIGPTGVGKTEIARRLAKLANAPFIKIEATKFTEVGYVGRDVDTIIRDLTEYSIKQTRELEMRRVRTQAEDAAEDRILDALVPPSRGTSGEPERGEDSNARQTFRKRLREGKCDDLEIEIEIAQPVPQMDVMTPPGMEEMAEQLRGMFAGLARDKKKPKKMKVKEAFKLIVEEEAAKRINEDDLRTAAIANVEQNGIVFLDEIDKIAARQESGGADVSRQGVQRDLLPLVEGTTVNTRYGMVRTDHILFIASGAFHLSRPSDLIPELQGRFPIRVELESLTAQDFVRILSDTDASLIKQYSALLGTEDVQLDFKPDGIERLAELAFSVNERTENIGARRLYTVMEKLLEELSFDATASSGKTITIDAAYVDAQLSEAASSQDLARYVL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.702 kDa

MSANHMTPGEIVSELDKFIIGQNRAKRAVAVALRNRWRRQQVAEPLRHEIHPKNILMIGPTGVGKTEIARRLAKLANAPFIKIEATKFTEVGYVGRDVDTIIRDLTEYSIKQTRELEMRRVRSHAEDAAEDRILDALVPPPRGASGEPERGEDNSARQTFRKRLREGKIDDLEIEIEIAQPMPQMDVMTPPGMEEMAEQLRGMFAGLARDKKKSKKIKVREAFKLIVEEEAAKRVNEDDLRAAAITNVEQNGIVFLDEIDKIAARQETGGADVSRQGVQRDLLPLVEGTTVNTRYGMVRTDHILFIASGAFHLARPSDLIPELQGRFPIRVELDSLSAEDFVSILSETDASLIKQYTALLGTEDVKLEFTDDGIRRLAELAFSVNERTENIGARRLYTVMEKLLEELSFDASANSGEVITIDAAYVDLQLAETAGSQDLARYVL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.584 kDa

MSEMTPREIVKELDRFIIGQKKAKRAVAIALRNRWRRMKLNKELRYEITPKNILMIGPTGVGKTEIARRLAKLAKAPFIKVEATKFTEIGYVGKEVDSIIRDLTDSAIKMIKSTAIKKNKKRAKELAEERILDVLVPTIKNNWKKTNTNNNSEATLQIFRKKLREGTLDDKEIEINVAVTPMGIEIMAPPGMEELTNQLQSLFQNLTGNKRNIKKLKIKDAMKLLIEEEAAKLINLEELKKEAIYAVEQHGIVFIDEIDKICRNHGSSGPDISREGVQRDLLPLIEGCTVSTKHGMVKTDHILFIASGAFQVSTPSDLIPELQGRLPIRVELQALTINDFELILTEPKASVTMQYQALLKTEKVKINFTKEGIRHIAEAAWKVNESMENIGARRLHTVLERLMEDISFHASDHRNEITITIDEKYVQKHLDKLISNEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.812 kDa

MSEMTPREIVSELDSYIIGQNKAKRAVAIALRNRWRRMQLNEMLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAIKMVRLQSIDKNRTRAEELAEERILDVLIPPAKNNWGQAEEHQEPSSARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTNQLQSMFQNLGGQKQKPRKLKIKEAFKLLVEEEAAKLVNPEELKEQAIEAVEQHGIVFIDEIDKICKRGGQSSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQTASPSDLIPELQGRLPIRVELQALTTEDFERILTEPSASLTEQYKALMGTEGVNIEFTAEGIRRIAEAAWQVNESTENIGARRLHTVLERLMEDISYDASEINGQSITIDADYVRNHLDELVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.906 kDa

MSNMTPKEIKHELDRHIIGQDNAKRAVAIALRNRWRRMQLDKEMRQEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVESIVRDLVDVAIKLTREEEMAKVAHKAEDLAEDRILDILIPPAKTGNDWETVKTEDSATRQSFRKKLREGKLDDKEVEIDLPAPQIGVEIMAPPGMEEMTNQLQGMFQSMSGKDKTKKRKMKIKEALKVLIESEAAKLVNEEDIKEKALFSAENNGIIFIDEIDKICKRGDSAGPDVSREGVQRDLLPLIEGSTVSTKHGMVKTDHMLFIASGAFQVAKPSDLIPELQGRLPIRVELEALTEEDLAKILTEPKASLSEQYKALLATEGITLQFSKDGIDKIAKSAWHVNETTENIGARRLHTLMERILDELSYEASERKGESITIDENYVANTLDDLLENEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.729 kDa

MSEMTPRKIVKELNKYIIGQNNAKRAVAIALRNRWRRMQLNSELRNEITPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDLAIKMIRLQIIKKNKKHAKKRAEERILKILIPVPKDNWNEENLKEKPEKTIQIFRKKLQEGKLDNKEIEIQIAATPIGIEIMSPPGMEELTNQLQSLFQNLSGKKKNLRKLKIKDAMKIIIEEEAAKLINLEELKEKAIYSVEQNSIVFIDEIDKICKHHSSASNSDVSREGVQRDLLPLIEGCTVSTKHGSVKTDHILFIASGAFQTSTPSDLIPELQGRLPIRVELNALTVDDFERILTEPNASITTQYKALIKTEGVDIIFTKKGIRKIAEASWKINESMENIGARRLYTVLEKLMEDISFNSNEKFGQKIYIDEKYVNLHLDKLIENEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.441 kDa

MSASTMTPGEIVSELDKYIIGQNRAKRAVAVALRNRWRRQQVADPLRHEIHPKNILMIGPTGVGKTEIARRLAKLANAPFIKIEATKFTEVGYVGRDVDTIIRDLTEFSIKQTRELEMRRVRSHAEDAAEDRILDVLVPPARNAMGEPQRDDGNTTRQTFRKRLREGSLDDLEIEIDIAQATPQLDVMTPPGMEEMAEQLRGMFAGLARDKTKPKKIKVKEAFKLIIEEEAAKRVNEDDLRAAAIANVEQNGIVFLDEIDKIAARQESGGADVSRQGVQRDLLPLVEGTTVNTRYGMVRTDHILFIASGAFHLSRPSDLIPELQGRFPIRVELDSLSADDFVRILSETDASLVKQYTALLATEDVQLAFTEDGIKRLAELAFSVNERTENIGARRLYTVMEKLLEELSFDAGASSGQSVTIDAAYVDAQLSEAASSQDLARYVL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.729 kDa

MSANHMTPGEIVSELDKFIIGQNRAKRAVAVALRNRWRRQQVAEPLRHEIHPKNILMIGPTGVGKTEIARRLAKLANAPFIKIEATKFTEVGYVGRDVDTIIRDLTEYSIKQTRELEMRRVRSHAEDAAEDRILDALVPPPRGASGEPERGEDNSARQTFRKRLREGKIDDLEIEIEIAQPMPQMDVMTPPGMEEMAEQLRGMFAGLARDKKKSKKIKVREAFKLIVEEEAAKRVNEDDLRAAAITNVEQNGIVFLDEIDKIAARQETGGADVSRQGVQRDLLPLVEGTTVNTRYGMVRTDHILFIASGAFHLARPSDLIPELQGRFPIRVELDSLSAEDFVNILSETDASLIKQYTALLGTEDVKLEFTDDGIRRLAELAFSVNERTENIGARRLYTVMEKLLEELSFDASANSGEVITIDAAYVDLQLAETAGSQDLARYVL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.446 kDa

MSEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAMKLVRQQEIAKNRARAEDAAEERILDALLPPAKNQWGEVENHDSHSSTRQAFRKKLREGQLDDKEIEIDVSAGVSMGVEIMAPPGMEEMTNQLQSLFQNLGSDKTKKRKMKIKDALKTLIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIEFTTEAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.249 kDa

MSEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAMKLVRQQEIAKNRARAEDAAEERILDALLPPAKNQWGEVESHDSHSSTRQAFRKKLREGQLDDKEIEIDVSAGVSMGVEIMAPPGMEEMTNQLQSLFQNLGSDKTKKRKMKIKDGLKALIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFCVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.372 kDa

MSEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAMKLVRQQEIAKNRARAEDVAEERILDALLPPAKNQWGEVENHDSHSSTRQAFRKKLREGQLDDKEIEIDVSAGVSMGVEIMAPPGMEEMTNQLQSLFQNLGSDKTKKRKMKIKDALKALIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.712 kDa

MSEMTPREIVSELDKHIIGQDAAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAIKMVRMQSIDKNRYRAEELAEERVLDVLIPPAKNNWGQAEQPQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMSPPGMEEMTSQLQSMFQNLGGQKQKPRKLKIKDAMKLLIEEEAAKLVNPEELKQEAIDAVEQHGIVFIDEIDKICKRGGNSSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVASPSDLIPELQGRLPIRVELKALTTHDFERILTEPNASITVQYKALMATEGVNIEFTEDGIKRIAQAAWQVNETTENIGARRLHTVLERLVEDISYDASEMNGQTVIIDAEYVSKHLDVLVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

444 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.732 kDa

MSEMTPREIVSELDKHIIGQDAAKRSVSIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAIKMVRMQSIDKNRYRAEEMAEERILDVLIPPAKNNWGQAEQPQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMSPPGMEEMTSQLQSMFQNLGGQKQKPRKLKIKDAMKLLIEEEAAKLVNPEELKQEAIDAVEQHGIVFIDEIDKICKRGGNASGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVASPSDLIPELQGRLPIRVELKALTTHDFERILTEPNASITVQYKALMATEGVNIEFTEDGIKRIAQAAWQVNETTENIGARRLHTVLERLVEDISYDASEMNGQTVTIDAEYVSKHLDVLVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.537 kDa

MTQMTPPEIVSELDKHIVGQARAKKAVAIALRNRWRRARIDEPLRSEITPKNILMIGPTGVGKTEIARRLARLANAPFIKVEATKFTEVGYVGRDVDTIIRDLVEIAIKDGRERAMRVVRDRALDAAEDRVLDVLLPPARPVGFSEPAQPQDSATRQKFRKKLREGELDDKEVEIEVASAPMQAEIFAPPGMEELTQQIQGMFQNLGNSRKKLRKLPIREALKLLADEEAARLINDEEVKTEALRAVEQNGIVFLDEVDKIAARADAHGADVSRQGVQRDLLPLVEGTTISTKYGMIKTDHILFIASGAFHLSKPSDLIPELQGRFPIRVELESLSVEDFERILTSTDACLTRQYEALLATDGVTLSFTPEGIRRLAEIAYQVNEKTENIGARRLYTVMEKLLEEVSFEAGKVGVDKLTVDAAYVDARLEVLAQREDLARYVL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.142 kDa

MSEMTPREIVHELDRHIIGQAEAKRAVAIALRNRWRRMQLSNELRQEVAPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDTIIRDLTDMALKMMREQEMEKVRFRAHEAAEERVLDVLLPPARSNWGEAEKSETGTHTRQIFRKKLREGELDDKEIEIDVAAPQMGVEIMAPPGMEEMTNQLQGLFQNMSAGNTHKRKLKVKDALKQLVEEEAGRLLNPEELKEKTIHAVENNGIVFIDEFDKICKRGESSGPDVSREGVQRDLLPLIEGCTVNTKHGMVRTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELKNLTVDDFERILTEPNASLTEQYQALMATEQVKIEFTAEGIRSIAEAAWQVNERTENIGARRLHTVLEKLMEDISYDAADNAGQLFSIDAEYVNRYLGALIEDEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.872 kDa

MSEMTPREIVSELNRHIIGQDKAKRAVAIALRNRWRRMQLEESLRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVESIIRDLTDVAVKLTHQQAMEKVKFRAEELAEERVLDALLPPPRDAWGQAEQKEENSSTRQVFRKKLREGQLNDKEIEINVAVPQMGVEIMAPPGMEEMTNQLQGLFQNLAGDTKKKRKMKIKDALKALVEEEAAKLVNQEELKEQAIYNVENNGIVFIDEIDKICKRGEVSGPDVSREGVQRDLLPLIEGSTVSTKHGMVRTDHILFIASGAFQVAKPSDLIPELQGRLPIRVELEALSSNDFKRILTEPKASLTEQYVALMKTEQVDVQFTEDGIKQIADAAWQVNETTENIGARRLHTVLERLMDEISFDATEKAGQAFVIDAAYVKARLGELVEDEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.913 kDa

MSEMTPREIVHELNRHIIGQDKAKRSVAIALRNRWRRMQLEESLRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVETIIRDLTDVAVKMTHQQAMEKVKFRAEEQAEERVLDALLPPARDAWGQSEQKEDTSNTRQIFRKKLREGQLDDKEIEIDVAAPQMGVEIMAPPGMEEMTNQLQGMFQNLAGDTKKKRKLKIKDAMKALAEEEAAKLVNQEELKESAIFNVENNGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLIEGSTVSTKHGMVKTDHILFVASGAFQVAKPSDLIPELQGRLPIRVELEALTSNDFKRILTEPKASLTEQYIALMKTESVDVEFTEDGITQIAEAAWTVNETTENIGARRLHTVMERLMDEISYDATEKAGEKFVINAAYVKDRLGDTIEDEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.9 kDa

MSEMTPREIVSELNRHIIGQDKAKRAVAIALRNRWRRMQLEESLRVEVTPKNILMIGPTGVGKTEIARRLAKLANVPFIKVEATKFTEVGYVGKEVESIIRDLTDVAVKLTHQQAMEKVKFRAEELAEERVLDALLPPPRDAWGQAEQKEENSSTRQVFRKKLREGQLNDKEIEINVAVPQMGVEIMAPPGMEEMTNQLQGLFQNLAGDTKKKRKMKIKDALKALVEEEAAKLVNQEELKEQAIYNVENNGIVFIDEIDKICKRGEVSGPDVSREGVQRDLLPLIEGSTVSTKHGMVRTDHILFIASGAFQVAKPSDLIPELQGRLPIRVELEALSSNDFKRILTEPKASLTEQYVALMKTEQVDVQFTEDGIKQIADAAWQVNETTENIGARRLHTVLERLMDEISFDATEKAGQAFVIDAAYVKARLGELVEDEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.83 kDa

MSEMTPREIVSELNRHIIGQDKAKRAVAIALRNRWRRMQLEESLRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVESIIRDLTDVAVKLTHQQAMEKVKFRAEELAEERVLDALLPPPRDAWGQAEQKEENSSTRQVFRKKLREGQLNDKEIEINVAVPQMGVEIMAPPGMEEMTNQLQGLFQNLAGDTKKKRKMKIKDALKALVEEEAAKLVNQEELKEQAIYNVENNGIVFIDEIDKICKRGEVSGPDVSREGGQRDLLPLIEGSTVSTKHGMVRTDHILFIASGAFQVAKPSDLIPELQGRLPIRVELEALSSNDFKRILTEPKASLTEQYVALMKTEQVDVQFTEDGIKQIADAAWQVNETTENIGARRLHTVLERLMDEISFDATEKAGQAFVIDAAYVKARLGELVEDEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.88 kDa

MSEMTPREIVHELNRHIIGQDKAKRSVAIALRNRWRRMQLEESLRVEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVETIIRDLTDVAVKMTHQQAMEKVKFRAEEQAEERILDALLPPARDSWGQVEQKEDTSNTRQIFRKKLREGQLDDKEIEIDVAAPQMGVEIMAPPGMEEMTNQLQGMFQNLAGDTKKKRKLKIKDAMKALAEEEAAKLVNQEELKEAAIFNVENNGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLIEGSTVSTKHGMVKTDHILFVASGAFQVAKPSDLIPELQGRLPIRVELEALSSNDFKRILTEPKASLTEQYIALMKTEDVDIEFTEDGITRIAEAAWTVNETTENIGARRLHTVMERLMDEISYDAAEQSGAKFVIDAAYVQARLGDTIEDEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.593 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQTIIIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.581 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQTITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.581 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQTITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.593 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQTIIIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.594 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQNITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.593 kDa

MSEMTPREIVSELDKHIIGQNNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQNITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.581 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQTITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.581 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQTITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.593 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQTIIIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.594 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQNITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.594 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQNITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.594 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQNITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.581 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQTITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.581 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQTITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.581 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQTITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.594 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQNITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.594 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQNITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.581 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQTITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.593 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQTIIIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.581 kDa

MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQTITIDADYVSKHLDALVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.715 kDa

MSEMTPREIVSELDGYIVGQHNAKRAVAIALRNRWRRMQLDEALRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRLQSIEQNRFRAEELAEERVLDVLIPPAKNNWGQPEESGEPSSARQNFRKKLREGQLDEKEIEINLAAAPMGVEIMAPPGMEEMTNQLQSMFKNLAGQKQKPRKIKIKEAMKLLVEEEAAKLVNPEELKEKAIEAVEQHGIVFIDEIDKICKRDEVSGLDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELEALTTEDFERILTEPSASLTTQYIALMATEGVSITFTEDGIKRIAEAAWQVNECTENIGARRLHTVLERLMEDISYDASEWNGKTISIDADYVHGHLDELVSDEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.963 kDa

MSEMTPREIVHELDRHIIGQKNAKRAVSVALRNRWRRMQLSGDLRQEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVETIIRDLADIAVKMAKEQETKKVKYRAEEAAEERILDVLLPPAENQWGEKEQNEDKGTRQTFRKKLREGQLDDKEIEIDVALPQVGVEIMAPPGMEEMTNQLQGMFQNLSGSQKKKKKLKIKEAFKLLIEEEAARLVNQEDLKANAIESLEQNGIVFIDEIDKICKREGSNSGGDVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQMAKPSDLIPELQGRLPIRVELEALTAGDFIRILTEPNASLTEQYIALLKTEGVDVDFTQDGIERIAQAAWQVNERTENIGARRLHTVMERLMEEISFDASEKSGEQLTVDAKYVNDHLEMLVENEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.963 kDa

MSEMTPREIVHELDRHIIGQKNAKRAVSVALRNRWRRMQLSGDLRQEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVETIIRDLADIAVKMAKEQETKKVKYRAEEAAEERILDVLLPPAENQWGEKEQNEDKGTRQTFRKKLREGQLDDKEIEIDVALPQVGVEIMAPPGMEEMTNQLQGMFQNLSGSQKKKKKLKIKEAFKLLIEEEAARLVNQEDLKANAIESLEQNGIVFIDEIDKICKREGSNSGGDVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQMAKPSDLIPELQGRLPIRVELEALTAGDFIRILTEPNASLTEQYIALLKTEGVDVDFTQDGIERIAQAAWQVNERTENIGARRLHTVMERLMEEISFDASEKSGEQLTVDAKYVNDHLEMLVENEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.892 kDa

MSEMTPPQIVSELDKFIIGQEKAKRAVSIALRNRWRRMQLNSELRYEVTPKNILMIGPTGVGKTEIARRLAKLADSPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAIKMIRIKNINKNKVRVEEIVEEKILDVLVPTPKKNWTESEKNESLAKTIQTFRKKLREGVLDEKEIEINILSTTMGVEIMAPPGMEELTNQLQSLFQNLGGHKKSSRRLKIKDAIVLLTEEEAAKLINQEEIKKEAINAVEQNGIVFIDEIDKICRRGDSSGPDISREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQTSTPSDLIPELQGRLPIKVELQALTIDDFEKILTEPTASITAQYKALMETEGVYINFTKEGIRNIAEAAWKVNESIENIGARRLHTVLEKLMEDISFNASDNKGNTIEINSNYVEEHLDQLTSNEDLGRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.906 kDa

MSEMTPPQIVSELDKFIIGQEKAKRAVSIALRNRWRRMQLNSELRYEVTPKNILMIGPTGVGKTEIARRLAKLADSPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAIKMIRIKNIKKNKVRVEEIVEEKILDVLVPTPKKNWTESEKNESLAKTIQTFRKKLREGVLDEKEIEINILSTTMGVEIMAPPGMEELTNQLQSLFQNLGGHKKSSRRLKIKDAIVLLTEEEAAKLINQEEIKKEAINAVEQNGIVFIDEIDKICRRGDSSGPDISREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQTSTPSDLIPELQGRLPIKVELQALTIDDFEKILTEPTASITAQYKALMETEGVYINFTKEGIRNIAEAAWKVNESIENIGARRLHTVLEKLMEDISFNASDNKGNTIEINSNYVEEHLDQLTSNEDLGRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.03 kDa

MSEMTPPQIVSELNKFIIGQEQAKKAVAIALRNRWRRMQLNNELRHEITPKNILMIGPTGVGKTEIARRLAKLANSPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAIKMIRVKNIEKNKLRVEEIVEERILDVLVPRPKNNWTENEKNESLLNTLQVFRKKLREGILDEKEIEINVLASTMGVEIMAPPGMEELTSQLQSLFQNLGGHKKNTRRLKIKDAVLLLKEEEAAKLINQEEIKKEAINAVEQNGIVFVDEIDKICKRRDSSGPDVSREGVQRDLLPLVEGCTVSTKYGMVKTDHILFIASGAFQTSTPSDLIPELQGRLPIKVELQPLTINDFEKILTEPTASITAQYKALMKTEGVCINFTKEGIRNIAEAAWKVNESMENIGARRLHTILEKLMEDISFNACDNVGKTIEINSEYVGKHLDQLISNEDLGRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.906 kDa

MSEMTPPQIVSELDKFIIGQEKAKRAVSIALRNRWRRMQLNSELRYEVTPKNILMIGPTGVGKTEIARRLAKLADSPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAIKMIRIKNIKKNKVRVEEIVEEKILDVLVPTPKKNWTESEKNESLAKTIQTFRKKLREGVLDEKEIEINILSTTMGVEIMAPPGMEELTNQLQSLFQNLGGHKKSSRRLKIKDAIVLLTEEEAAKLINQEEIKKEAINAVEQNGIVFIDEIDKICRRGDSSGPDISREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQTSTPSDLIPELQGRLPIKVELQALTIDDFEKILTEPTASITAQYKALMETEGVYINFTKEGIRNIAEAAWKVNESIENIGARRLHTVLEKLMEDISFNASDNKGNTIEINSNYVEEHLDQLTSNEDLGRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.905 kDa

MSAMTPREIVHELNKHIVGQEEAKRAVAIALRNRWRRMQLDSSLRDEITPKNILMIGPTGVGKTEIARRLAKLADAPFLKVEATKFTEVGYVGRDVESIIRDLADMAVKMLREQEMKRHEHRALDAAEDRILDALLPPPRDFNEDSQRTNADSSTRQLFRKKLREGELDDKEIEIDLRSSGAGVEIMAPPGMEEMTSQLQSMFSNLSSDKRKTRKMKVADAMKRVKDEEAAKLVNEEEIKQKAIQAVEQNGIVFIDEIDKVAKRSENTSSDVSREGVQRDLLPLIEGSTVSTKYGSIRTDHILFIASGAFHLSKPSDLIPELQGRLPIRVELQALTPDDFKRILTEPDASLVQQYEALMGTEGVKLTFADDAIARIAEVAYKVNETTENIGARRLHTVLERLLESLSYDAGDQVTDTFEVTADYVDEKLGELSEDEDLSRYIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.067 kDa

MSHMTPQEIVHELDKHIIGQEAAKRSVAIALRNRWRRQQVGEPLRHEITPKNILMIGPTGVGKTEIARRLARLADAPFIKIEATKFTEVGYVGRDVDSIIRDLVESAIKQAREHEIRKNKPLAEDRAEERILDALLPSARDSGFDANPSEENNATRQKFRKKLREGELDDKEIDIEITMSQASMEIFAPPGMEELTSQIQGMFQNMGASKKKSRKLRIREARKLLTEEEAARLINDEELKLNAVQNVEQNGIVFLDEIDKITSRSEVSSSDISRQGVQRDLLPLVEGTTISTKYGMIRTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSADDFKQILTNTDACLIRQYQALLKTEGIELNFSEDAIERLAEIAFSVNEITENIGARRLHTVMEKLLEDISFNATRYSGSTHVIDAAYVDERLGKLSQSEDLARYVL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

50.089 kDa

MSYMTPQEIVHELDKHIIGQDTAKRAVAIALRNRWRRQQVDEPLRHEITPKNILMIGPTGVGKTEIARRLARLANAPFIKIEATKFTEVGYVGRDVDSIIRDLVESAIKQAREREIRKNQPLAEDRAEERILDALLPPARDLGFEASPSEESNATRQKFRKKLREGELDDKEIEIEVAMAQTSMEIFAPPGMEELTSQIQGMFQNMGSGKRKMRKLRIREARKLLTEEEAARLVNDEELKLGAVQNVEQNGIVFLDEIDKITSRSEVSGSDVSRQGVQRDLLPLVEGTTISTKYGMIRTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELESLSAEDFKQILTNTDACLIRQYQALLKTEGIELNFSEDAIGRLAEIAFSVNERTENIGARRLHTVMEKLLEDISFNATRYGGSTHVIDAVYVDERLGKLSQSEDLARYVL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.

49.804 kDa

MSEMTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRHQSIEKMRYRAEELAEERILDVLIPPAKNNWGVPDESQEPSATRQTFRKKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTNQLQSMFQNIAGQKQKPRKIKIKEALKLLIEEEAAKLVNPEELKQQAIDAVEQHGIVFIDEIDKICKRGQTSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELQALTTDDFERILTEPSASLTEQYKALMATEGVTIEFTREGIRKIAEAAWQVNERTENIGARRLHTVLERLMEDISYDASESSGQSITIDAEYVGKHLDELVADEDLSRFIL

hslU

ATP-dependent protease ATPase subunit HslU

443 amino acids

ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis.

Belongs to the ClpX chaperone family. HslU subfamily.