hsdS

Type-1 restriction enzyme EcoEI specificity protein

594 amino acids

The M and S subunits together form a methyltransferase (MTase) that methylates two adenine residues in complementary strands of a bipartite DNA recognition sequence. In the presence of the R subunit the complex can also act as an endonuclease, binding to the same target sequence but cutting the DNA some distance from this site. Whether the DNA is cut or modified depends on the methylation state of the target sequence. When the target site is unmodified, the DNA is cut. When the target site is hemimethylated, the complex acts as a maintenance MTase modifying the DNA so that both strands become methylated. Subunit S dictates DNA sequences specificity. The EcoEI enzyme recognizes 5'-GAGN(7)ATGC-3'.

Belongs to the type-I restriction system S methylase family.

66.344 kDa

MAVEKLITDHIDIWSSALQTRSMAGRGSNGKIDLYGIKKLRELILELAVRGKLVPQDPNDEPASELLKRIAAEKTELVKQGKIKKQKPLLRISEDEKPFELPEGWEWITLSEIATINPKIEVTDDEQEISFVPMPCISTRFDGAHDQEIKKWGEVKKGYTHFADGDIALAKITPCFENSKAVIFKGLKGGVGVGTTELHVARPISSELNLQYILLNIKSPHYLSMGESMMTGSAGQKRVPRSFFENYPIPFPPNTEQARIVGTFSKLMFLCDQLEQQSLTSLDAHQQLVETLLATLTDSQNAEELAENWARISQYFDTLFTTEASIDALKQTILQLAVMGKLVSQDPNDEPASELLKRVEQEKVQLVKEGKIKKQKPLPPVSDDEKPFELPIGWEWCRIGEIIANMDAGWSPACSPEPSPNEDIWGVLKTTAVQSLEYREQENKTLPNSKLPRPQYEVHDGDILVTRAGPKNRVGVSCLVEKTRSKLMISDKIIRFHLISDDISAKYISLCLNRGVTADYLEASKSGMAESQMNISQENLRSAPIALPPTAIQLKVISTIEDFFKVCDQLKSRLQSAQQTQLHLADALTDAALN

hsdS

Type-1 restriction enzyme EcoAI specificity protein

589 amino acids

The M and S subunits together form a methyltransferase (MTase) that methylates two adenine residues in complementary strands of a bipartite DNA recognition sequence. In the presence of the R subunit the complex can also act as an endonuclease, binding to the same target sequence but cutting the DNA some distance from this site. Whether the DNA is cut or modified depends on the methylation state of the target sequence. When the target site is unmodified, the DNA is cut. When the target site is hemimethylated, the complex acts as a maintenance MTase modifying the DNA so that both strands become methylated. Subunit S dictates DNA sequences specificity. The EcoAI enzyme recognizes 5'-GAGN(7)GTCA-3'.

Belongs to the type-I restriction system S methylase family.

66.693 kDa

MSVEKLIVDHMETWTSALQTRSTAGRGSSGKIDLYGIKKLRELILELAVRGKLVPQDPNDEPASELLKRIAAEKAELVKQGKIKKQKPLPEISEEEKPFELPDGWEWTTLTRIAEINPKIDVSDDEQEISFIPMPLISTKFDGSHEFEIKKWKDVKKGYTHFANGDIAIAKITPCFENSKAAIFSGLKNGIGVGTTELHVARPFSDIINRKYLLLNFKSPNFLKSGESQMTGSAGQKRVPRFFFENNPIPFPPLQEQERIIIRFTQLMSLCDQLEQQSLTSLDAHQQLVETLLGTLTDSQNVEELAENWARISEHFDTLFTTEASVDALKQTILQLAVMGKLVPQDPNDEPASELLKRIAQEKAQLVKEGKIKKQKPLPPISDEEKPFELPEGWEWCRLGSIYNFLNGYAFKSEWFTSVGLRLLRNANIAHGVTNWKDVVHIPNDMISDFENYILSENDIVISLDRPIINTGLKYAIISKSDLPCLLLQRVAKFKNYANTVSNSFLTIWLQSYFFINSIDPGRSNGVPHISTKQLEMTLFPLLPQSEQDRIISKMDELIQTCNKLKYIIKTAKQTQLHLADALTDAAIN

hsdS

Type-1 restriction enzyme EcoBI specificity protein

474 amino acids

The M and S subunits together form a methyltransferase (MTase) that methylates two adenine residues in complementary strands of a bipartite DNA recognition sequence. In the presence of the R subunit the complex can also act as an endonuclease, binding to the same target sequence but cutting the DNA some distance from this site. Whether the DNA is cut or modified depends on the methylation state of the target sequence. When the target site is unmodified, the DNA is cut. When the target site is hemimethylated, the complex acts as a maintenance MTase modifying the DNA so that both strands become methylated. Subunit S dictates DNA sequences specificity. The EcoBI enzyme recognizes 5'-TGAN(8)TGCT-3'.

Belongs to the type-I restriction system S methylase family.

53.513 kDa

MSFNSTSKELIEQNINGLLSIHDSWLRISMDSVANITNGFAFKSSEFNNRKDGVPLIRIRDVLKGNTSTYYSGQIPEGYWVYPEDLIVGMDGDFNATIWCSEPALLNQRVCKIEVQEDKYNKRFFYHALPGYLSAINANTSSVTVKHLSSRTLQDTLLPLPPLAEQKIIAEKLDTLLAQVDSTKARLEQIPQILKRFRQAVLAAAVTGRLTKEDKDFITKKVELDNYKILIPEDWSETILNNIINTQRPLCYGVVQPGDDIKDGIELIRVCDINDGEVDLNHLRKISKEIDLQYKRSKVRKNDILVTIVGAIGRIGIVREDINVNIARAVARISPEYKIIVPMFLHIWLSSPVMQTWLVQSSKEVARKTLNLKDLKNAFVPLPSIEEQHEIVRRVEQLFAYADSIEKQVNNALARVNNLTQSILAKAFRGELTAQWRAENPDLISGENSAAALLEKIKAERAASGGKKASRKKF

hsdS

Type-1 restriction enzyme StySJI specificity protein

469 amino acids

The M and S subunits together form a methyltransferase (MTase) that methylates two adenine residues in complementary strands of a bipartite DNA recognition sequence. In the presence of the R subunit the complex can also act as an endonuclease, binding to the same target sequence but cutting the DNA some distance from this site. Whether the DNA is cut or modified depends on the methylation state of the target sequence. When the target site is unmodified, the DNA is cut. When the target site is hemimethylated, the complex acts as a maintenance MTase modifying the DNA so that both strands become methylated. Subunit S dictates DNA sequences specificity. The StySJI enzyme recognizes 5'-GAGN(6)GTRC-3'.

Belongs to the type-I restriction system S methylase family.

51.91 kDa

MSGGKLPEGWATSTINEMCNLNPKLKLDDDLDVGFMPMAGVPTTYLGKCNFETKKWSEVKKGFTQFQNDDVIFAKITPCFENGKAVVIKEFPNGYGAGSTEYYVLRSINGLINPHWLFALVKTKDFLTNGALNMSGSVGHKRVTKEFLENYGVPVPPLAEQKVIAEKLDTLLAQVDSTKARLEQIPQILKRFRQSVIVAAVNGQLTKELHKKNKFKLTELNISIPSLWKISEIGQFADVKGGKRLPKGESLIAENTGFPYIRAGQLKNGTVLPEGQLYLEEYIQKSISRYTVSSGDLYITIVGACIGDAGIIPDVYNNANLTENAAKICNLNENIFNRFLSLWLRSSYLQDIINSEIKSGAQGKLALARIKSLPLILPPLQEQHEIVRRVEQLFAYADTIEKQVNNALTRVNSLTQSILAKAFRGELTAQWRAENPELISGENSAAALLEKIKAERAASGGKKTSRKKA

hsdS

Type-1 restriction enzyme EcoKI specificity protein

464 amino acids

The M and S subunits together form a methyltransferase (MTase) that methylates two adenine residues in complementary strands of a bipartite DNA recognition sequence. In the presence of the R subunit the complex can also act as an endonuclease, binding to the same target sequence but cutting the DNA some distance from this site. Whether the DNA is cut or modified depends on the methylation state of the target sequence. When the target site is unmodified, the DNA is cut. When the target site is hemimethylated, the complex acts as a maintenance MTase modifying the DNA so that both strands become methylated. Subunit S dictates DNA sequences specificity. The EcoKI enzyme recognizes 5'-AACN(6)GTGC-3'.

Belongs to the type-I restriction system S methylase family.

51.395 kDa

MSAGKLPEGWVIAPVSTVTTLIRGVTYKKEQAINYLKDDYLPLIRANNIQNGKFDTTDLVFVPKNLVKESQKISPEDIVIAMSSGSKSVVGKSAHQHLPFECSFGAFCGVLRPEKLIFSGFIAHFTKSSLYRNKISSLSAGANINNIKPASFDLINIPIPPLAEQKIIAEKLDTLLAQVDSTKARFEQIPQILKRFRQAVLGGAVNGKLTEKWRNFEPQHSVFKKLNFESILTELRNGLSSKPNESGVGHPILRISSVRAGHVDQNDIRFLECSESELNRHKLQDGDLLFTRYNGSLEFVGVCGLLKKLQHQNLLYPDKLIRARLTKDALPEYIEIFFSSPSARNAMMNCVKTTSGQKGISGKDIKSQVVLLPPVKEQAEIVRRVEQLFAYADTIEKQVNNALARVNNLTQSILAKAFRGELTAQWRAENPDLISGENSAAALLEKIKAERAASGGKKASRKKS

hsdS

Type-1 restriction enzyme StySPI specificity protein

463 amino acids

The M and S subunits together form a methyltransferase (MTase) that methylates two adenine residues in complementary strands of a bipartite DNA recognition sequence. In the presence of the R subunit the complex can also act as an endonuclease, binding to the same target sequence but cutting the DNA some distance from this site. Whether the DNA is cut or modified depends on the methylation state of the target sequence. When the target site is unmodified, the DNA is cut. When the target site is hemimethylated, the complex acts as a maintenance MTase modifying the DNA so that both strands become methylated. Subunit S dictates DNA sequences specificity. The StySPI enzyme recognizes 5'-AACN(6)GTRC-3'.

Belongs to the type-I restriction system S methylase family.

51.19 kDa

MNRGKLPEGWATAPVSTVTTLIRGVTYKKEQALNYLQDDYLPIIRANNIQNGKFDTTDLVFVPKNLVKESQKISPEDIVIAMSSGSKSVVGKSAHQRLPFECSFGAFCGALRPEKFISPNYIAHFTKSSFYRNKISSLSAGANINNIKPASFDLINIPIPSLAEQKIIAEKLDTLLAQVDSTKARLEQIPQILKRFRQAVLAAAVSGTLTTALRNSHSLIGWHSTNLGALIVDSCNGLAKRQGLNGNEITILRLADFKDAQRIIGNERKIKLDSKEENKYSLENDDILVIRVNGSADLAGRFIEYKSNGDIEGFCDHFIRLRLDSNKIMSRFLTYIANEGEGRFYLRNSLSTSAGQNTINQTSIKGLSFLLPPLKEQAEIVRRVEQLFAYADTIEKQVNNALTRVNSLTQSILAKAFRGELTAQWRAENPDLISGKNSAAALLEKIKAERAVSGGKKTSRKKA

hsdS

Type-1 restriction enzyme EcoDI specificity protein

444 amino acids

The M and S subunits together form a methyltransferase (MTase) that methylates two adenine residues in complementary strands of a bipartite DNA recognition sequence. In the presence of the R subunit the complex can also act as an endonuclease, binding to the same target sequence but cutting the DNA some distance from this site. Whether the DNA is cut or modified depends on the methylation state of the target sequence. When the target site is unmodified, the DNA is cut. When the target site is hemimethylated, the complex acts as a maintenance MTase modifying the DNA so that both strands become methylated. Subunit S dictates DNA sequences specificity. The EcoDI enzyme recognizes 5'-TTAN(7)GTCY-3'.

Belongs to the type-I restriction system S methylase family.

49.894 kDa

MSAGKLPVDWKTVELGELIKLSTGKLDANAADNDGQYPFFTCAESVSQINSWAFDTSAVLLAGNGSFSIKKYTGKFNAYQRTYVIEPILIKTEFLYWLLRGNIKKITENGRGSTIPYIRKGDITDISVALPSPSEQTLIAEKLDTLLAQVESTKARLEQIPQILKRFRQAVLTFAMNGELTKEWRSQNNNPAFFPAEKNSLKQFRNKELPSIPNNWSWMRFDQVADIASKLKSPLDYPNTIHLAPNHIESWTGKASGYQTILEDGVTSAKHEFYTGQIIYSKIRPYLCKVTIATFDGMCSADMYPINSKIDTHFLFRWMLTNTFTDWASNAESRTVLPKINQKDLSEIPVPTPPLPEQHEIVRRVEQLFAYADTIEKQVNNALARVNNLTQSILAKAFRGELTAQWRAENPDLISGENSAAALLEKIKAERAASGGKKASRKKS

hsdS

Type-1 restriction enzyme EcoR124II specificity protein

404 amino acids

The M and S subunits together form a methyltransferase (MTase) that methylates two adenine residues in complementary strands of a bipartite DNA recognition sequence. In the presence of the R subunit the complex can also act as an endonuclease, binding to the same target sequence but cutting the DNA some distance from this site. Whether the DNA is cut or modified depends on the methylation state of the target sequence. When the target site is unmodified, the DNA is cut. When the target site is hemimethylated, the complex acts as a maintenance MTase modifying the DNA so that both strands become methylated. Subunit S dictates DNA sequences specificity. The EcoR124/3i enzyme recognizes 5'-GAAN(6)RTCG-3'.

Belongs to the type-I restriction system S methylase family.

46.179 kDa

MSEMSYLEKLLDGVEVEWLPLGEITKYEQPTKYLVKAKDYHDTYTIPVLTAGKTFILGYTNETHGIYQASKAPVIIFDDFTTANKWVDFDFKAKSSAMKMVTSCDDNKTLLKYVYYWLNTLPSEFAEGDHKRQWISNYSQKKIPIPCPDNPEKSLAIQSEIVRILDKFTALTAELTAELNMRKKQYNYYRDQLLSFKEGEVEWKTLGEIGKWYGGGTPSKNKIEFWENGSIPWISPKDMGRTLVDSSEDYITEEAVLHSSTKLIPANSIAIVVRSSILDKVLPSALIKVPATLNQDMKAVIPHENILVKYIYHMIGSRGSDILRAAKKTGGSVASIDSKKLFSFKIPVPNINEQQRIVEILDKFDTLTNSITEGLPREIELRQKQYEYYRDLLFSFPKPETVSN