hoxd4a

Homeobox protein Hox-D4a

236 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family. Deformed subfamily.

27.132 kDa

MAMSSYMVNSKYVDPKFPPCEEYSQNSYIPEQSPGYYSPSQDTDFQHPGIYSRSNYSEQPYICSTVQGSSVQPRGHVQDQASTPSPFPAQTEQCPAVQISGSRTCGQQQNTKTQNGIPTKQPAVVYPWMKKVHVTTVNPDYTGPEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIESAHTLSLSERQIKIWFQNRRMKWKKDHKLPNTKGRSASVGNQHAQHAQKDSQTEITTL

hoxd4a

Homeobox protein Hox-D4a

233 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family. Deformed subfamily.

26.753 kDa

MAMSSYMVNSKYVDPKFPPCEEYSQNNYIPEQGSDYYSSSQDTDFQHPGIYPRSNYTEQPFGCTAVQEPTVPRGHVHDKSGQPSPFNAQTESGAPVLVAGPRTCGQQQNTKSQNGTQAKQPAVVYPWMKKVHVTTVNPDYTGSEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWTKDHKLPNTKGRSAPASSHLQSIHKDQTDITSL