hoxb1b

Homeobox protein Hox-B1b

307 amino acids

Sequence-specific transcription factor. Part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments.

Belongs to the Antp homeobox family. Labial subfamily.

34.21 kDa

MNSYLDYTIYNRGSNTYSSKVGCFPVEQEYLPSACASTNSYIPEGRPVGGNTFTSAPHETHGTSYAQIQSQPFHLNVDMGKTGHSNFCKQTRPPHSDYGHQHVLTQADDHMRLQSPGFSVVNMGANIGTYSESNCRPGSVSASHYQSYAYGEPEPHGYGSFSKYQVSPDSDSDSKTNIKQAPTFDWMKVKRNPPKTVKVAEYGIHGQQNIIRTNFTTKQLTELEKEFHFNKYLTRARRVEVAATLELNETQVKIWFQNRRMKQKKREKEGTAPVIKRVTLCSSGQNADHSTSSSPGASPTSDSSTAI

hoxb1b

Homeobox protein Hox-B1b

280 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family. Labial subfamily.

31.221 kDa

MSSYLDYPVCNRGTNIFSAKPGYHNLNHGYLSSNSCATSDSYAPDGRLAAPTSAPHQSPGLPLHHQTHLDLPFAATGNSVYGSHLDYGHHQYGLAPEQDRSYVHPQVSPLGTNMAPYTGDSCGPAAANGSQYLHFGNGEQRLQEYPDNVYARLPPQSKKESEHVEETCKTFDWMKVKRNPPKTGGASEFGVPGQHNVIRTNFTTKQLTELEKEFHFNKYLTRARRVEVAASLELNETQVKIWFQNRRMKQKKREKLGGVLVHREKASGPESSPKAKESEP