holD

DNA polymerase III subunit psi

137 amino acids

Part of the beta sliding clamp loading complex, which hydrolyzes ATP to load the beta clamp onto primed DNA to form the DNA replication pre-initiation complex (PubMed:2040637). DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity. The exact function of the psi subunit is unknown.

15.174 kDa

MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRALTVSPDQVLQLTPEKIAMLPQGSHCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAALWQQICTYEHDFFPRND

holD

DNA polymerase III subunit psi

134 amino acids

DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity. The exact function of the psi subunit is unknown (By similarity).

15.718 kDa

MNRRDLLLQEMGISQWELYRPEVLQGSVGISVAENIRLITVSDENISSSPLLADVLLSLNLKKENCLCLNYDQIQHMECKQPIRYWLLSENSDQIDRTLPFCKQAEQVYRSPSWQQFQSNHQAKRALWQQIQQP