hipB

Antitoxin HipB

94 amino acids

Antitoxin component of a type II type II toxin-antitoxin (TA) system. Neutralizes the toxic effect of cognate toxin HipA. Represses the hipBA operon promoter (By similarity).

10.767 kDa

MLWTYDMMSFQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTSLTTFFKILQSLELSMTLCDAKNASPEAAEQQDLEW

hipB

Antitoxin HipB

88 amino acids

Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the toxic effect of cognate toxin HipA (PubMed:20616060). Also neutralizes the toxic effect of non-cognate toxin YjjJ (PubMed:28430938). Binds to operator sites with the consensus sequence 5-'TATCCN(8)GGATA-3' to repress the hipBA operon promoter (PubMed:8021189, PubMed:19150849); binding of HipB(2) to DNA induces a 70 degree bend (PubMed:19150849). This forces HipA dimerization, which blocks HipA's active site and thus its toxic action (PubMed:26222023). May play a role in biofilm formation (PubMed:23329678).

10.016 kDa

MMSFQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAKNASPESTEQQNLEW

hipB

Antitoxin HipB

78 amino acids

Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the toxic effect of cognate toxin HipA; overexpression in wild-type or a hipAB deletion temporarily inhibits cell growth. Binds operator DNA; in the ternary phosphoserine-HipA-HipB-DNA complex the DNA is bent about 125 degrees.

Belongs to the HipB antitoxin family.

8.502 kDa

MASPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVYISTVFKILDGLGIDIVSAQTSDTETNGWY