hha

Hemolysin expression-modulating protein Hha

72 amino acids

Down-regulates hemolysin expression, in complex with H-NS, and can also stimulate transposition events in vivo. Modifies the set of genes regulated by H-NS; Hha and Cnu (YdgT) increase the number of genes DNA bound by H-NS/StpA and may also modulate the oligomerization of the H-NS/StpA-complex. Binds DNA and influences DNA topology in response to environmental stimuli. Decreases biofilm formation (By similarity).

Belongs to the Hha/YmoA/Cnu family.

8.628 kDa

MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

hha

Hemolysin expression-modulating protein Hha

72 amino acids

Down-regulates hemolysin expression, in complex with H-NS, and can also stimulate transposition events in vivo. Modifies the set of genes regulated by H-NS; Hha and Cnu (YdgT) increase the number of genes DNA bound by H-NS/StpA and may also modulate the oligomerization of the H-NS/StpA-complex. Binds DNA and influences DNA topology in response to environmental stimuli. Decreases biofilm formation (By similarity).

Belongs to the Hha/YmoA/Cnu family.

8.628 kDa

MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

hha

Hemolysin expression-modulating protein Hha

72 amino acids

Down-regulates hemolysin (hly) expression in complex with H-NS (PubMed:1956303, PubMed:10778755, PubMed:11790731, PubMed:21600204). Stimulates transposition events in vivo (PubMed:8145648). Modifies the set of genes regulated by H-NS; Hha and Cnu (YdgT) increase the number of genes DNA bound by H-NS/StpA and may also modulate the oligomerization of the H-NS/StpA-complex (PubMed:23543115). Binds DNA and influences DNA topology in response to environmental stimuli; does not however interact with DNA in the absence of H-NS (PubMed:23543115). Involved in persister cell formation, acting downstream of mRNA interferase (toxin) MqsR (PubMed:19909729). Decreases biofilm formation by repressing the transcription of fimbrial genes fimA and ihfA, and by repressing the transcription of tRNAs corresponding to rare codons, which are abundant in type 1 fimbrial genes (PubMed:18545668).

Belongs to the Hha/YmoA/Cnu family.

8.628 kDa

MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

hha

Hemolysin expression-modulating protein Hha

72 amino acids

Binds to H-NS and modifies the range of genes it silences; H-NS alone silences core genes while the H-NS-Hha complex (and presumably also H-NS-YdgT) silences genes acquired by horizontal gene transfer (PubMed:19521501). Plays a role silencing virulence factors in the absence of factors that induce pathogenicity (PubMed:17307861). Probably requires H-NS to bind DNA (By similarity).

Belongs to the Hha/YmoA/Cnu family.

8.614 kDa

MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

hha

Hemolysin expression-modulating protein Hha

72 amino acids

Interacts with H-NS and in this complex might contact DNA, which could provide an additional surface for DNA binding to the H-NS-Hha complex; may not bind DNA in the absence of H-NS (PubMed:23515315). In vitro improves the ability of H-NS to bind DNA under a precise set of conditions (PubMed:23515315).

Belongs to the Hha/YmoA/Cnu family.

8.614 kDa

MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

hha

Hemolysin expression-modulating protein Hha

72 amino acids

Down-regulates hemolysin expression, in complex with H-NS, and can also stimulate transposition events in vivo. Modifies the set of genes regulated by H-NS; Hha and Cnu (YdgT) increase the number of genes DNA bound by H-NS/StpA and may also modulate the oligomerization of the H-NS/StpA-complex. Binds DNA and influences DNA topology in response to environmental stimuli. Decreases biofilm formation (By similarity).

Belongs to the Hha/YmoA/Cnu family.

8.628 kDa

MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

hha

Hemolysin expression-modulating protein Hha

72 amino acids

Down-regulates hemolysin expression, in complex with H-NS, and can also stimulate transposition events in vivo. Modifies the set of genes regulated by H-NS; Hha and Cnu (YdgT) increase the number of genes DNA bound by H-NS/StpA and may also modulate the oligomerization of the H-NS/StpA-complex. Binds DNA and influences DNA topology in response to environmental stimuli. Decreases biofilm formation (By similarity).

Belongs to the Hha/YmoA/Cnu family.

8.628 kDa

MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

hha

Hemolysin expression-modulating protein Hha

72 amino acids

Down-regulates hemolysin expression, in complex with H-NS, and can also stimulate transposition events in vivo. Modifies the set of genes regulated by H-NS; Hha and Cnu (YdgT) increase the number of genes DNA bound by H-NS/StpA and may also modulate the oligomerization of the H-NS/StpA-complex. Binds DNA and influences DNA topology in response to environmental stimuli. Decreases biofilm formation (By similarity).

Belongs to the Hha/YmoA/Cnu family.

8.628 kDa

MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

hha

Hemolysin expression-modulating protein Hha

72 amino acids

Down-regulates hemolysin (hly) expression in complex with H-NS (PubMed:1956303, PubMed:10778755, PubMed:11790731, PubMed:21600204). Stimulates transposition events in vivo (PubMed:8145648). Modifies the set of genes regulated by H-NS; Hha and Cnu (YdgT) increase the number of genes DNA bound by H-NS/StpA and may also modulate the oligomerization of the H-NS/StpA-complex (PubMed:23543115). Binds DNA and influences DNA topology in response to environmental stimuli; does not however interact with DNA in the absence of H-NS (PubMed:23543115). Involved in persister cell formation, acting downstream of mRNA interferase (toxin) MqsR (PubMed:19909729). Decreases biofilm formation by repressing the transcription of fimbrial genes fimA and ihfA, and by repressing the transcription of tRNAs corresponding to rare codons, which are abundant in type 1 fimbrial genes (PubMed:18545668).

Belongs to the Hha/YmoA/Cnu family.

8.628 kDa

MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

hha

Hemolysin expression-modulating protein Hha

72 amino acids

Binds to H-NS and modifies the range of genes it silences; H-NS alone silences core genes while the H-NS-Hha complex (and presumably also H-NS-YdgT) silences genes acquired by horizontal gene transfer (PubMed:19521501). Plays a role silencing virulence factors in the absence of factors that induce pathogenicity (PubMed:17307861). Probably requires H-NS to bind DNA (By similarity).

Belongs to the Hha/YmoA/Cnu family.

8.614 kDa

MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

hha

Hemolysin expression-modulating protein Hha

72 amino acids

Interacts with H-NS and in this complex might contact DNA, which could provide an additional surface for DNA binding to the H-NS-Hha complex; may not bind DNA in the absence of H-NS (PubMed:23515315). In vitro improves the ability of H-NS to bind DNA under a precise set of conditions (PubMed:23515315).

Belongs to the Hha/YmoA/Cnu family.

8.614 kDa

MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

hha

Hemolysin expression-modulating protein Hha

72 amino acids

Down-regulates hemolysin expression, in complex with H-NS, and can also stimulate transposition events in vivo. Modifies the set of genes regulated by H-NS; Hha and Cnu (YdgT) increase the number of genes DNA bound by H-NS/StpA and may also modulate the oligomerization of the H-NS/StpA-complex. Binds DNA and influences DNA topology in response to environmental stimuli. Decreases biofilm formation (By similarity).

Belongs to the Hha/YmoA/Cnu family.

8.628 kDa

MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR