hdrB2

Ferredoxin/F(420)H(2)-dependent CoB-CoM heterodisulfide reductase subunit B

300 amino acids

Part of a complex that catalyzes the reversible reduction of CoM-S-S-CoB to the thiol-coenzymes H-S-CoM (coenzyme M) and H-S-CoB (coenzyme B). Catalyzes the transfer of electrons from ferredoxin to CoM-S-S-CoB during methanogenesis from acetate. Electrons transfer from ferredoxin to CoM-S-S-CoB via HdrA2, HdrC2 and HdrB2. In addition, the complex can use electron bifurcation to direct electron pairs from reduced coenzyme F420 towards the reduction of both ferredoxin and CoB-CoM heterodisulfide. This activity may take place during Fe(III)-dependent anaerobic methane oxidation.

Belongs to the HdrB family.

32.819 kDa

MAKLSLFRGCIVPNRYPGIEKATKLCLQKLEVDAVDLPGASCCPAPGVFKSFDKATWLALASRNIVLSERMGRDILTVCNGCYGSLADANIELKNDPEMKACTNSCLKEIGMEYKGTAEVRHIIEFLYKELGPEKLKSFITTPLDLKVALHYGCHLIKPSKERNLGETEAPVFFDELVEATGAKSVDYTDKMMCCGAGGGVRSGHAAESLEMLEHKLACIRNAGVDCIVNACPFCHLQFDRGQLAVNEKFGTDYSIPVLHYSQLLGLALGFSPDELGIEQNAIQNIEFLAKIYEISAGLR

hdrB2

CoB--CoM heterodisulfide reductase subunit B 2

295 amino acids

Part of a complex that catalyzes the reversible reduction of CoM-S-S-CoB to the thiol-coenzymes H-S-CoM (coenzyme M) and H-S-CoB (coenzyme B).

Belongs to the HdrB family.

32.789 kDa

MKYAFFLGCIMPHRYPGVEKATKIVMEELGVELEYMPGASCCPAPGVFGSFDQKTWLTLAARNLCIAEEMGLDIVTVCNGCYGSLFEAAHILHENKEALDFVNEKLDKIGKQYKGTIKVRHFAELIYKDIGVDKIKEKVVKPLDVLNVAIHYGCHFLKPSDVKHLDSPERPKLLEEIVAATGAKPVMYRDYLMCCGAGGGVRARFLPTALDMTKEKIRNMLEAGADCTVNVCPFCHLQFDRGQVEIKEKFGEEYKLPVLHLSQLLGLAFGMKPEDLAVSVHAIPVDPVLKKLGIE

hdrB2

H(2)/formate:CoB-CoM heterodisulfide,ferredoxin reductase subunit B2

293 amino acids

Part of a complex that catalyzes the reversible reduction of CoM-S-S-CoB to the thiol-coenzymes H-S-CoM (coenzyme M) and H-S-CoB (coenzyme B).

Belongs to the HdrB family.

32.026 kDa

MKYAFFLGCIMPNRYAGVESATRTVMEKLGVELVDMPGASCCPAPGVFGSFDQKTWLTLAARNLVIAEEMGTDIVTVCNGCYGSLYEAAHMLHENKEALAMVNEQLKEIGKEYKGTVHVRHFAELIYKEIGVDKIRENVVKPLAVNIGVHYGCHFLKPTAAKGLGNAEHPTMLDELVEATGAKSVDYKDKMMCCGAGGGVRAKELDLALSMTQEKIENMLAVGADATVNVCPFCQLQFDRGQVEIKEKLGNEYNFPVVHLSQLLGLAMGMDPKEVALDVNFISPEPLLQKLGY