hcnA

Hydrogen cyanide synthase subunit HcnA

105 amino acids

A three-component membrane-bound flavoenzyme that catalyzes the formation of hydrogen cyanide, a secondary metabolite, by transfer of electrons to a cyanide-resistant branch of the aerobic respiratory chain. Contributes to suppression of black root rot of tobacco (PubMed:16453871).

11.525 kDa

MRQIDRNFDIQPLQHADMTISLNGQPVTAALGETVLSVIQATGLRQVARNDHGQLVGAYCGMGVCHCCLVQIDGRHKRRACQTLVKPGMQVQTLSNRITETEPTL

hcnA

Hydrogen cyanide synthase subunit HcnA

104 amino acids

A three-component membrane-bound flavoenzyme that catalyzes the formation of hydrogen cyanide, a secondary metabolite, by transfer of electrons to a cyanide-resistant branch of the aerobic respiratory chain.

11.427 kDa

MHLLERQHDIQPLSRADMTIHLNGQPVAAAAGETVLNVLNAVGLRRLARNDHGQASGAFCGMGVCHCCLVAIDGRPKRRACQTVVRPGMRVETESNRFDQEERP