hcaC

3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit

106 amino acids

Part of the multicomponent 3-phenylpropionate dioxygenase, that converts 3-phenylpropionic acid (PP) and cinnamic acid (CI) into 3-phenylpropionate-dihydrodiol (PP-dihydrodiol) and cinnamic acid-dihydrodiol (CI-dihydrodiol), respectively. This protein seems to be a 2Fe-2S ferredoxin.

Belongs to the bacterial ring-hydroxylating dioxygenase ferredoxin component family.

11.329 kDa

MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATVECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGGDIFIDLPEAQP

hcaC

3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit

106 amino acids

Part of the multicomponent 3-phenylpropionate dioxygenase, that converts 3-phenylpropionic acid (PP) and cinnamic acid (CI) into 3-phenylpropionate-dihydrodiol (PP-dihydrodiol) and cinnamic acid-dihydrodiol (CI-dihydrodiol), respectively. This protein seems to be a 2Fe-2S ferredoxin.

Belongs to the bacterial ring-hydroxylating dioxygenase ferredoxin component family.

11.329 kDa

MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATVECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGGDIFIDLPEAQP

hcaC

3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit

106 amino acids

Part of the multicomponent 3-phenylpropionate dioxygenase, that converts 3-phenylpropionic acid (PP) and cinnamic acid (CI) into 3-phenylpropionate-dihydrodiol (PP-dihydrodiol) and cinnamic acid-dihydrodiol (CI-dihydrodiol), respectively. This protein seems to be a 2Fe-2S ferredoxin (By similarity).

Belongs to the bacterial ring-hydroxylating dioxygenase ferredoxin component family.

11.329 kDa

MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATVECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGGDIFIDLPEAQP

hcaC

3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit

106 amino acids

Part of the multicomponent 3-phenylpropionate dioxygenase, that converts 3-phenylpropionic acid (PP) and cinnamic acid (CI) into 3-phenylpropionate-dihydrodiol (PP-dihydrodiol) and cinnamic acid-dihydrodiol (CI-dihydrodiol), respectively. This protein seems to be a 2Fe-2S ferredoxin.

Belongs to the bacterial ring-hydroxylating dioxygenase ferredoxin component family.

11.329 kDa

MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATVECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGGDIFIDLPEAQP

hcaC

3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit

106 amino acids

Part of the multicomponent 3-phenylpropionate dioxygenase, that converts 3-phenylpropionic acid (PP) and cinnamic acid (CI) into 3-phenylpropionate-dihydrodiol (PP-dihydrodiol) and cinnamic acid-dihydrodiol (CI-dihydrodiol), respectively. This protein seems to be a 2Fe-2S ferredoxin.

Belongs to the bacterial ring-hydroxylating dioxygenase ferredoxin component family.

11.329 kDa

MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATVECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGGDIFIDLPEAQP

hcaC

3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit

106 amino acids

Part of the multicomponent 3-phenylpropionate dioxygenase, that converts 3-phenylpropionic acid (PP) and cinnamic acid (CI) into 3-phenylpropionate-dihydrodiol (PP-dihydrodiol) and cinnamic acid-dihydrodiol (CI-dihydrodiol), respectively. This protein seems to be a 2Fe-2S ferredoxin.

Belongs to the bacterial ring-hydroxylating dioxygenase ferredoxin component family.

11.359 kDa

MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATVECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGSDIFIDLPEAQP

hcaC

3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit

106 amino acids

Part of the multicomponent 3-phenylpropionate dioxygenase, that converts 3-phenylpropionic acid (PP) and cinnamic acid (CI) into 3-phenylpropionate-dihydrodiol (PP-dihydrodiol) and cinnamic acid-dihydrodiol (CI-dihydrodiol), respectively. This protein seems to be a 2Fe-2S ferredoxin.

Belongs to the bacterial ring-hydroxylating dioxygenase ferredoxin component family.

11.315 kDa

MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATVECPLHAASFCLKTGKALCLPATDPLSTYPVHVEGGDIFIDLPEAQP

hcaC

3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit

106 amino acids

Part of the multicomponent 3-phenylpropionate dioxygenase, that converts 3-phenylpropionic acid (PP) and cinnamic acid (CI) into 3-phenylpropionate-dihydrodiol (PP-dihydrodiol) and cinnamic acid-dihydrodiol (CI-dihydrodiol), respectively. This protein seems to be a 2Fe-2S ferredoxin (By similarity).

Belongs to the bacterial ring-hydroxylating dioxygenase ferredoxin component family.

11.329 kDa

MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATVECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGGDIFIDLPEAQP

hcaC

3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit

105 amino acids

Part of the multicomponent 3-phenylpropionate dioxygenase, that converts 3-phenylpropionic acid (PP) and cinnamic acid (CI) into 3-phenylpropionate-dihydrodiol (PP-dihydrodiol) and cinnamic acid-dihydrodiol (CI-dihydrodiol), respectively. This protein seems to be a 2Fe-2S ferredoxin.

Belongs to the bacterial ring-hydroxylating dioxygenase ferredoxin component family.

11.536 kDa

MSQLFVCTVEELPDGGARKVEYTPDIALFHYDGEFFAVDDRCSHGNASISEGYLEDNATVECPLHTASFCLRTGKALCLPATDPLKTYPVVVKDGNIYITVSEEQ