hacA

Transcriptional activator hacA

350 amino acids

Transcriptional activator involved in the unfolded protein response (UPR) pathway. Recognizes and binds to the UPR element (UPRE) in the promoter of UPR-regulated genes. Increases the synthesis of endoplasmic reticulum-resident proteins required for protein folding as well as components of the secretory pathway (By similarity).

Belongs to the bZIP family.

38.164 kDa

MKSADRFSPVKMEDAFANSLPTTPSLEVPVLTVSPADTSLQTKNVVAQTKPEEKKPAKKRKSWGQELPVPKTNLPPRKRAKTEDEKEQRRIERVLRNRAAAQTSRERKRLEMEKLESEKIDMEQQNQFLLQRLAQMEAENNRLSQQVAQLSAEVRGSRHSTPTSSSPASVSPTLTPTLFKQEGDEVPLDRIPFPTPSVTDYSPTLKPSSLAESPDLTQHPAVSVGGLEGDESALTLFDLGASIKHEPTHDLTAPLSDDDFRRLFNGDSSLESDSSLLEDGFAFDVLDSGDLSAFPFDSMVDFDTEPVTLEDLEQTNGLSDSASCKAASLQPSHGASTSRCDGQGIAAGSA

hacA

Transcriptional activator hacA

345 amino acids

Transcriptional activator involved in the unfolded protein response (UPR) pathway. Recognizes and binds to the UPR element (UPRE) in the promoter of UPR-regulated genes. Increases the synthesis of endoplasmic reticulum-resident proteins required for protein folding as well as components of the secretory pathway (By similarity).

Belongs to the bZIP family.

37.563 kDa

MSCDMEKTMSSVDSLPATPASEVPVLTVSPADTSLNSADVKTQEVKPEEKKPAKKRKSWGQELPVPKTNLPPRKRAKTEDEKEQRRIERVLRNRAAAQTSRERKRLEMEKLENEKIQMEQQNQFLLQRLSQMEAENNRLSQQLAQLAAEVRGSRANTPMPGSPATASPTLTPTLFKQERDELPLERIPFPTPSLSDYSPTLKPSTLAESSDVAQHPAVSVAGLEGDGSALPLFDLGSDLKHHSTDDVAAPLSDDDFNRLFHGDSSVEPDSSVFEDGLAFDVLEGGDLSAFPFDSMVNFDSEPVTLEGIEMAHGLPDETTCKTSSVQPGFGASTTRCDGQGIAAGC