GRX5

Monothiol glutaredoxin-5, mitochondrial

150 amino acids

Monothiol glutaredoxin involved in iron-sulfur biogenesis (PubMed:11950925, PubMed:12730244). Required for normal iron homeostasis (PubMed:11950925, PubMed:12730244). Protects cells against oxidative damage due to reactive oxygen species (PubMed:12730244). Collaborates with BOL1 in iron-sulfur protein assembly when the iron-sulfur cluster is inserted into the target protein (PubMed:27532773).

Belongs to the glutaredoxin family. Monothiol subfamily.

16.931 kDa

MFLPKFNPIRSFSPILRAKTLLRYQNRMYLSTEIRKAIEDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFAAYNVLEDPELREGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEEAQALVPEEEEETKDR

GRX5

Monothiol glutaredoxin-5, mitochondrial

150 amino acids

Monothiol glutaredoxin involved in iron-sulfur biogenesis (PubMed:11950925, PubMed:12730244). Required for normal iron homeostasis (PubMed:11950925, PubMed:12730244). Protects cells against oxidative damage due to reactive oxygen species (PubMed:12730244). Collaborates with BOL1 in iron-sulfur protein assembly when the iron-sulfur cluster is inserted into the target protein (PubMed:27532773).

Belongs to the glutaredoxin family. Monothiol subfamily.

16.931 kDa

MFLPKFNPIRSFSPILRAKTLLRYQNRMYLSTEIRKAIEDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFAAYNVLEDPELREGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEEAQALVPEEEEETKDR

grx5

Monothiol glutaredoxin-5

146 amino acids

Thiol reductase involved in the biogenesis of iron-sulfur clusters. Required for normal iron homeostasis. Required for integrity of mitochondrial DNA. May play a crucial role in responses to nitrosative and osmotic stresses.

Belongs to the glutaredoxin family. Monothiol subfamily.

16.533 kDa

MNSMFRFWIPKTSISMQLRMLSTQTRQALEQAVKEDPIVLFMKGTPTRPMCGFSLKAIQILSLENVASDKLVTYNVLSNDELREGIKEFSDWPTIPQLYINGEFVGGSDILASMHKSGELHKILKEINALAPEQPKDSEEETTKKD

grx5

Monothiol glutaredoxin-5

146 amino acids

Thiol reductase involved in the biogenesis of iron-sulfur clusters. Required for normal iron homeostasis. Required for integrity of mitochondrial DNA. May play a crucial role in responses to nitrosative and osmotic stresses.

Belongs to the glutaredoxin family. Monothiol subfamily.

16.533 kDa

MNSMFRFWIPKTSISMQLRMLSTQTRQALEQAVKEDPIVLFMKGTPTRPMCGFSLKAIQILSLENVASDKLVTYNVLSNDELREGIKEFSDWPTIPQLYINGEFVGGSDILASMHKSGELHKILKEINALAPEQPKDSEEETTKKD

grx5

Monothiol glutaredoxin-5, mitochondrial

143 amino acids

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters. Required for normal iron homeostasis (By similarity).

Belongs to the glutaredoxin family. Monothiol subfamily.

16.016 kDa

MNSYLFRIGSKTSGFLRSTQFVRSYSKHVKSESYKKALEDVETQVAESPCILYMKGIPERPECGFSNTAVRILQAEGAVFTSYNVLKNNDMREAVKEFGDWPTIPQLYVKGQFIGGADILMGLYKSGELSKLLNEAGVVKKDE

GRX5

Monothiol glutaredoxin-5, mitochondrial

143 amino acids

Monothiol glutaredoxin involved in iron-sulfur biogenesis.

Belongs to the glutaredoxin family. Monothiol subfamily.

15.845 kDa

MFGRISTRALLRPAFTHRIPSVSLSRFLSTETKQAIESAIESAPVVLFMKGTPEFPQCGFSKATINMLGQQGVDPMKFAAYNVLEDAELREGVKEFSEWPTIPQLYVNKEFVGGCDIVMNMAQTGELAKLLEDADALVPEEEE

grx5

Monothiol glutaredoxin-5, mitochondrial

143 amino acids

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters. Required for normal iron homeostasis (By similarity).

Belongs to the glutaredoxin family. Monothiol subfamily.

16.016 kDa

MNSYLFRIGSKTSGFLRSTQFVRSYSKHVKSESYKKALEDVETQVAESPCILYMKGIPERPECGFSNTAVRILQAEGAVFTSYNVLKNNDMREAVKEFGDWPTIPQLYVKGQFIGGADILMGLYKSGELSKLLNEAGVVKKDE

GRX5

Monothiol glutaredoxin-5, mitochondrial

143 amino acids

Monothiol glutaredoxin involved in iron-sulfur biogenesis.

Belongs to the glutaredoxin family. Monothiol subfamily.

15.845 kDa

MFGRISTRALLRPAFTHRIPSVSLSRFLSTETKQAIESAIESAPVVLFMKGTPEFPQCGFSKATINMLGQQGVDPMKFAAYNVLEDAELREGVKEFSEWPTIPQLYVNKEFVGGCDIVMNMAQTGELAKLLEDADALVPEEEE