grpE1

Protein GrpE 1

221 amino acids

Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and GrpE. It is the nucleotide exchange factor for DnaK and may function as a thermosensor. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding.

Belongs to the GrpE family.

23.415 kDa

MTEETPGFDEKPDVPSGATPEDAEPKAAPSEGAAPAGDAAAAAQTAAQTAGLTAQLDQVRTALGERTADLQRLQAEYQNYRRRVERDRIAVKEIAIANLLTELLPTLDDIGRAREHGELVGGFKSVAESLETVAAKMGLQQFGKEGEPFDPTIHEALMHSYAPDVTETTCVAILQPGYRIGERTIRPARVAVAEPQPGAQTVKADEAEAADDKESGGPEEG

grpE1

Protein GrpE 1

202 amino acids

Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and GrpE. It is the nucleotide exchange factor for DnaK and may function as a thermosensor. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding.

Belongs to the GrpE family.

24.068 kDa

MKNKKEEKINNLKKEEKINNLKKEEKINNLKKEEKEKNDDVQNKIIDLLEIKLKKSQEKIINMQLKNHEEILKLNYRLNSDIEKSRKFSLEKVIIEFLPIIDNIERALSVIKDKKEAFYLEIINKMNFIFSLLEEILSEFNVSKINEKNISFDPEIHQAMSINYNDEIEDNHVVDVMQSGYMLHKARLLRPAMVIVSKRKNN

grpE1

Protein GrpE 1

198 amino acids

Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and GrpE. It is the nucleotide exchange factor for DnaK and may function as a thermosensor. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding.

Belongs to the GrpE family.

22.794 kDa

MNIDNDLLSKNKEAKVVSENSTVEINDVTNSDSKNTDNDFQTEELNNFEKIFLNLNSDLLNQQLLVKNNLKLYKIRAEKEINRAYKFSLKSFISSLFPVIDSMEYALNLFKKDDKILCLIFNELDNVSQSLMNLLVKFGVTSIKDINIAFNPDIHQAITTQVSKDIKNNYVISIMQKGYLLYDRLLRPAMVIVSKNDI

grpE1

Protein GrpE 1

194 amino acids

Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and GrpE. It is the nucleotide exchange factor for DnaK and may function as a thermosensor. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding.

Belongs to the GrpE family.

23.147 kDa

MIHNEEEQLEKKIEKNQDPKINHKKYDSDNLIKKNLIQFLEIQLKESEEKIIEKEEIVEKEIVLIHNRFNKEIEKSIKFSLEKIIIDFLPIIDNIERALNLIETINLKQEKYTEILKKLQFICNLLEKFFYLFNIKKINDTNVLFNPSIHQAMSIHYTNDIISNQIVTVMQSGYILHKSRLLRPAMVVVSKEKI