grdB

Glycine reductase complex component B subunit gamma

438 amino acids

In the first step of glycine reductase, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination.

Belongs to the GrdB/GrdF/GrdH family.

47.369 kDa

MSKIRVVHYINQFFAGVGGEEKADIEPFIAESLPPVSQSLSNLIKDEAEVVGTVVCGDSYFGENLVEAKNRILEMIKSFNPDIVVAGPAFNAGRYGVAAATVTKAVQDELGIPAVTGMYIENPGADMFKKYAYIISTGNSAAAMRTALPAMAKFAMKLAKGEEIGGPVAEGYIERGIRFNMFKEDRGAKRAVAMLVKKLKGEEYETEYPMPSFDKVEPGKAIKDMSKAKIAIVTSGGIVPKGNPDRIESSSASKYGKYDIQGIDDLTSEGWETAHGGHDPIYANEDADRVIPVDVLRDMEKEGVIGELHRYFYSTTGNGTAVASSKKFAEEFTKELVADGVDAVILTSTUGTCTRCGASMVKEIERSGIPVVHIATVTPISLTVGANRIVPAIAIPHPLGNPALSHEEEKALRRKIVEKALEALQTEVEEQTVFERNY

grdB

Glycine reductase complex component B subunit gamma

436 amino acids

In the first step of glycine reductase, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination.

Belongs to the GrdB/GrdF/GrdH family.

46.6 kDa

MGKLRVVHYINQFFAGIGGEEKADIAPFVAEELPPISQNLDKLLGEDAEVVATVVCGDSFFGENLETAQATVLEMVKGASPDLFIAGPAFNAGRYGVAAGAITKAVQDTLGIPAVTGMYIENPGADMYKKSVYVMSTADSAAGMRKSLPALAKFALKYAKGEEIGSPAEEGYIERGIRVNGFKEDRGAKRAVAMLVKKLKGEEFVTEYPMPVFDNVVPGRAIVNMSKAKIAIVTSGGIVPKGNPDRIESSSASKYGKYDIDGVDDLTSEGWETAHGGHDPVYANEDADRVIPVDVLRDMEKEGVIGELHRYFYSTTGNGTAVLSSKQFAKEFTQELMAAGVDAVILTSTUGTCTRCGATMVKEIERSGIPVVHICTVTPIALTVGANRIVPAIAIPHPLGDPALSPAEEKALRRKIVEKSLKALETEIEEQTVFED

grdB

Glycine reductase complex component B subunit gamma

435 amino acids

In the first step of glycine reductase, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination (By similarity).

Belongs to the GrdB/GrdF/GrdH family.

46.175 kDa

MAKFRVVHYLNQFFGQIGGEEKADTAPLKKDGPVGPGTALNGAFKGEAEVVGTVICGDSYFAENMEEALKQILSMIKEYNPDLVVAGPAFNAGRYGTACGAVAEAVVKNLGIPAVTGMYPENPGVEMYKKSVYIIATADSAIGMRNAIPKMAALGLKLLKKEEIGTPEQEGYIARGIRKNYFAEERGAKRAVDMLIAKIKGENFTTELPMPAFDRVPPNPAIKDLSKATIALVTSGGIVPKGNPDRIESSSASKFGKYSIAGVKDLTSDTFETAHGGYDPVYANQDADRVLPVDVLREMEAEGKIGKLHDYYYATVGNGTSVANAAKFGQAIAADLKASGVDAVILTSTUGTCTRCGAAMVKEIERAGIPVVHMCTIVPISKTVGANRIVPTVAIPHPLGNPALPADEEKALRRKLVEKALKALTTEVEGQTVFD

grdB

Glycine reductase complex component B subunit gamma

429 amino acids

In the first step of glycine reductase, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination (By similarity).

Belongs to the GrdB/GrdF/GrdH family.

46.05 kDa

MRIVHYLNQFFGGIGGEEHAGVRPEVRPGPVGPGMALKAALGDAGEIVATVICGDSWFNENLEEAKATVLALIRQQNPDLVVAGPAFNAGRYGMACGAVAEVVSKELGIPVVTGMFLENPGVEVYRRYAWVVETGNSAASMRTAIPAMAALIRRLAAGQEPEPGTYLERGLRVNTFAAERGSARAVEMLVRKLKGEPYTTEYPMPSFDRVPPNPPVKDLSKAKIALVTSGGIVPKGNPDHIESSSASKYGKYYLGDLDDLTAETHQTAHGGYDPTYANADADRVLPVDVMRELEREGVIGKLHDYWYATVGNGTSVANARAYAREIAEDLKKYEVDAVILTSTUGTCTRCGATMVKEIERAGIPVVHVCTVVPISLTVGANRIVPAVAIPHPLGNPALPPDEERTLRRRLVMKALQALTTPVDGQTVFE

grdB

Glycine reductase complex component B subunit gamma

35 amino acids

In the first step of glycine reductase, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination.

Belongs to the GrdB/GrdF/GrdH family.

3.839 kDa

single

MIRVVHYIKEFFANIGGEEMAHVAPEVREGVVGPG