gpa-16

Guanine nucleotide-binding protein alpha-16 subunit

357 amino acids

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. In the 1-cell embryo, probably together with goa-1, controls nuclear rotation and spindle elongation during mitosis (PubMed:14534135). During the first embryonic cell divisons, plays a role in gpr-1/2 cortical localization and in the proper orientation of EMS blastomere mitotic spindle (PubMed:14534135).

Belongs to the G-alpha family.

41.328 kDa

MGCIMSQEDEAAKRRSKKIDRLLKEDGENSMRTIKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRGVVYGNIILSLNAIIHAMEQLKISFTTLDHESDARKLLMFSTTGEEDELPEELVVLMKSVWSDSGIQKALERSREYQLNDSAGYYLSQLDRICAPNYIPTQDDILRTRIKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVALSEYDMVLVEDCQTNRMRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEEASAYIQQQFEDMNKRTTGEKNQEIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY

gpa-16

Guanine nucleotide-binding protein alpha-16 subunit

354 amino acids

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. In the 1-cell embryo, probably together with goa-1, controls nuclear rotation and spindle elongation during mitosis. During the first embryonic cell divisons, plays a role in gpr-1/2 cortical localization and in the proper orientation of EMS blastomere mitotic spindle.

Belongs to the G-alpha family.

40.843 kDa

MGCIMSQTDDAASRSKKIDRLLKEDQENANKTVKLLLLGAGESGKSTILKQMRIIHDVGYTKDERRVFRSVVFGNIILSLNAIIAAMEQLKIEYEKEEHRADARKVLAFGATGEEDEIPDELAALMKSVWSDEGIQKAVARSREYQLNDSAEYYLSQLDRICEADYIPTQDDVLRTRIKTTGIVETQFIFKDRLFVVFDVGGQRSERKKWIHCFEDVTALIFCVAMSEYDMVLMEDRKTNRMRESLKVFDSICNSKWFVETSIILFLNKKDLFEEKIKKSPLTYCFPEYTGHDNFDDGSAFIQKQFEIVNKRQGGQKEIYTQFTCATDTNNIRFVFDAVTDIVIRDNLRTCGLY