gcvH3

Glycine cleavage system H protein 3

161 amino acids

The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein.

Belongs to the GcvH family.

18.106 kDa

MGKQEKDLGTAWEYQGCLIPKDLYYDIENQVWVRVNEDGTVTLGLTDVGQTRAGRLLHIRVKPVGTKVKKGKPVATLESGKWAGPVPALVEGEIVEVNPKVVEDPNYINIDPYGDAWIVKIKPTSEETLKRDLSELAHGEKAHEEMKKHIDEWDIVCMRCV

gcvH3

Putative glycine cleavage system H protein 3

149 amino acids

The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein (By similarity).

Belongs to the GcvH family.

17.004 kDa

MISNFLKSNNIKNNSPFRSFCTRYSESHEWIKFNHRNKTCTLGITKYASDQLKSIVNINLPDLNSTITRKQPFGNIESTKTVADLFSDVDGKAVLLNSDVIVDPTIVSHSPEDKGWLIKMESNDFESFNKMMTKSEYGQFLKDINKSNV

gcvH3

Probable glycine cleavage system H protein 3

146 amino acids

The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein.

Belongs to the GcvH family.

16.929 kDa

MKISFFNFPDDLLYEPERHVWIKVEENKVVSVGMTDLGQYLAGKIFQVSVPRRVGERVNNRTILFSVESAKWIGKIRLQIEGEVVDINERVIKNPSIINEDPYGSWIIKVSVTDVDLVKRAFKNIQDCRSQFEEEANRIVSWKNSS

gcvH3

Probable glycine cleavage system H protein 3

140 amino acids

The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein.

Belongs to the GcvH family.

16.336 kDa

MKILGFTFPDDLLYEPEKHVWVRIEDNSVVSIGVTDLGQYMAGKIFQVTAKQKGEKVNGRSVLFSIESAKWIGKFRLPIEGEVFDVNEEVVKNPSIINERPYDSWIVKIRVEDMDIIKRTFKPIQEVYKQFEEEAKRVVR

gcvH3

Probable glycine cleavage system H protein 3

136 amino acids

The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein.

Belongs to the GcvH family.

15.605 kDa

MQVEGFEFPDELYYYPEEHVWVKIEGDMVTVGITSLGQYMAGKIFQVTTKNKGEKVTPKSVIFTLESAKWIGKFRLPVEGEIVDINDEVVKNPTLINEKPYDAWIVKIKGDIKKEKLLPVSEAVKIFENDAKRVIR