galP

Galactose-proton symporter

464 amino acids

Uptake of galactose across the boundary membrane with the concomitant transport of protons into the cell (symport system).

Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family.

50.983 kDa

MPDAKKQGRSNKAMTFFVCFLAALAGLLFGLDIGVIAGALPFIADEFQITSHTQEWVVSSMMFGAAVGAVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIAPEKIRGSMISMYQLMITIGILGAYLSDTAFSYTGAWRWMLGVIIIPAILLLIGVFFLPDSPRWFAAKRRFVDAERVLLRLRDTSAEAKRELDEIRESLQVKQSGWALFKENSNFRRAVFLGVLLQVMQQFTGMNVIMYYAPKIFELAGYTNTTEQMWGTVIVGLTNVLATFIAIGLVDRWGRKPTLTLGFLVMAAGMGVLGTMMHIGIHSPSAQYFAIAMLLMFIVGFAMSAGPLIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLTMLNTLGNANTFWVYAALNVLFILLTLWLVPETKHVSLEHIERNLMKGRKLREIGAHD

galP

Galactose-proton symporter

464 amino acids

Uptake of galactose across the boundary membrane with the concomitant transport of protons into the cell (symport system).

Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family.

50.983 kDa

MPDAKKQGRSNKAMTFFVCFLAALAGLLFGLDIGVIAGALPFIADEFQITSHTQEWVVSSMMFGAAVGAVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIAPEKIRGSMISMYQLMITIGILGAYLSDTAFSYTGAWRWMLGVIIIPAILLLIGVFFLPDSPRWFAAKRRFVDAERVLLRLRDTSAEAKRELDEIRESLQVKQSGWALFKENSNFRRAVFLGVLLQVMQQFTGMNVIMYYAPKIFELAGYTNTTEQMWGTVIVGLTNVLATFIAIGLVDRWGRKPTLTLGFLVMAAGMGVLGTMMHIGIHSPSAQYFAIAMLLMFIVGFAMSAGPLIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLTMLNTLGNANTFWVYAALNVLFILLTLWLVPETKHVSLEHIERNLMKGRKLREIGAHD

galP

Porin-like protein GalP

410 amino acids

Probable transporter, possibly involved in the gallate degradation pathway. May play a role in the uptake of low gallate concentrations that may exist in the natural habitats of P.putida (Probable).

Belongs to the outer membrane porin (Opr) (TC 1.B.25) family.

45.398 kDa

MKCRTLYPLVPTFALAASLPLQALAEGFVDDAKASLTLRNFYMNRDYTGTASQGKAEEWTQSFIFDFKSGYTPGVVGFGVDVLGLYSIKLDGGKGTAGTQLLPVHDDGRPADDFGRTALAGKMRVSRTELKVGEWSPTLPILRADDGRSLPQTLQGAQVTSNELAGLSLYGGQFRQNSPRNDASMQDMSLFTRTAFTSDRFNFAGGEYRFNQERTLVGAWYAQLEDIYQQRYFQVQHQQPLGNWVLGANLGYFWGKDDGGAKAGELNNRTASGLFSAKLGGNTFYVGLQKVMGDDEWFRVNGASGGTLANDAFGSSYESARERSWQVRHDFNFVVLGIPGLTLMNRYIHGYNVHNASTQGRESELAYVVQSGPFKALNLKWRNSSQRRDWGSTNSFDENRLIVSYPLSLL

GALP

Galanin-like peptide

120 amino acids

Hypothalamic neuropeptide which binds to the G-protein-coupled galanin receptors (GALR1, GALR2 and GALR3). Involved in a large number of putative physiological functions in CNS homeostatic processes, including the regulation of gonadotropin-releasing hormone secretion (By similarity).

Belongs to the galanin family.

12.681 kDa

MALTVPLIVLAVLLSLMESPASAPVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGILDLWKAIDGLPYPQSQLASKRSLGETFAKPDSGVTFVGVPDVVPWKRIRPGTTRFQI

Galp

Galanin-like peptide

117 amino acids

Isoform 2: Exhibits antimicrobial activity against Gram-negative bacterias, inducing bacterial membrane blebbing (By similarity). Exhibits potent and dose-dependent vasoconstrictor and anti-edema activity in the cutaneous microvasculature, a physiologic effects which does not appear to be mediated via GALR1 or GALR2.

Belongs to the galanin family.

12.773 kDa

MACSVHLVLFLTILLSLAETPESAPAHRGRGGWTLNSAGYLLGPVLPVSSKADQGRKRDSALEILDLWKIIDGLPYSHSPRMTKRTMGETFVKANTGDMHILDKNVPKEEATLDSES

GALP

Galanin-like peptide

116 amino acids

Isoform 2: Exhibits potent and dose-dependent vasoconstrictor and anti-edema activity in the cutaneous microvasculature, a physiologic effects which does not appear to be mediated via GALR1 or GALR2. Exhibits antimicrobial activity against Gram-negative bacterias, inducing bacterial membrane blebbing (PubMed:23537644).

Belongs to the galanin family.

12.545 kDa

MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS

GALP

Galanin-like peptide

115 amino acids

Isoform 2: Exhibits potent and dose-dependent vasoconstrictor and anti-edema activity in the cutaneous microvasculature, a physiologic effects which does not appear to be mediated via GALR1 or GALR2. Exhibits antimicrobial activity against Gram-negative bacterias, inducing bacterial membrane blebbing (By similarity).

Belongs to the galanin family.

12.528 kDa

MAPSVPLVLLLVLLLSLAETPASAPAHQGRGGWTLNSAGYLLGPVLHLPQMGDQDRKRETALEILDLWKAIDGLPYSHPLQPSKRNVMEAFAKPEIGDLDVLSKKIPKEEDVLKS

Galp

Galanin-like peptide

115 amino acids

Hypothalamic neuropeptide which binds to the G-protein-coupled galanin receptors (GALR1, GALR2 and GALR3). Involved in a large number of putative physiological functions in CNS homeostatic processes, including the regulation of gonadotropin-releasing hormone secretion (By similarity).

Belongs to the galanin family.

12.6 kDa

MACSKHLVLFLTILLSLAETPDSAPAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMTKRSMGETFVKPRTGDLRIVDKNVPDEEATLNL