fnr

Anaerobic regulatory protein

273 amino acids

It is involved in the activation of genes necessary for anaerobic respiration.

30.887 kDa

MILFEIDQFYIIFVVLIKVLFMDTKIGRKVQSGGCAIHCQDCSISQLCIPFTLNEQELDQLDNIIERKKPIQKSQVLFKAGDPLNSLYAIRSGTIKTYTISETGEEQITSFQLPGDLVGFDAIMNMQHPSFAQALETSMVCEIPFDILDDLSGKMPKLRQQIMRLMSNEIKNDQEMILLLSKMNAEERLAAFIYNLSRRYSARGFSAREFRLTMTRGDIGNYLGLTVETISRLLGRLQKMGILSVQGKYITINDMVALIELSGTTKTNIKMGI

fnr

Anaerobic regulatory protein

257 amino acids

It is involved in the activation of genes necessary for anaerobic respiration. It probably also activates genes involved in the production of virulence factors.

28.929 kDa

MKILATETKLGRRVQSGGCAIHCQNCSISQLCIPFTLNQHELDQLDNIIERKKPIQKSQVLFKAGDELTSLYAIRSGTIKSYTISETGEEQITSFHLPGDLVGFDAIMNMQHPSFAQALETAMVCEIPFDILDDLSGKMPKLRQQIMRLMSNEIKSDQEMILLLSKMNAEERLAAFIYNLSQRYSARGFSAREFRLTMTRGDIGNYLGLTVETISRLLGRFQKLGVLSVQGKYITINNMAELIELSGTNKNKIQLII

fnr

Anaerobic regulatory protein

257 amino acids

It is involved in the activation of genes necessary for anaerobic respiration.

28.595 kDa

MKNFVAGAQSGRKIQSGGCAIHCQDCSISQLCIPFTLNEQELDQLDNIIERKKPIQKSQVLFKAGDSLNSIYAIRSGTIKSYTISESGEEQITSFHLPGDLVGFDAITQMQHPSFAQALETAMVCEIPFDILDDLAGKMPKLRQQILRLMSSEIKSDQEMILLLSKMNAEERLAAFIHNLSKRYSARGFSAREFRLTMTRGDIGNYLGLTVETISRLLGRFQKLGVISVQGKYITINDLNGLIELTGTNKTKITLVK

fnr

Fumarate and nitrate reduction regulatory protein

250 amino acids

Global transcription factor that controls the expression of over 100 target genes in response to anoxia. It facilitates the adaptation to anaerobic growth conditions by regulating the expression of gene products that are involved in anaerobic energy metabolism. When the terminal electron acceptor, O(2), is no longer available, it represses the synthesis of enzymes involved in aerobic respiration and increases the synthesis of enzymes required for anaerobic respiration (By similarity).

27.967 kDa

MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENNDALAQLAGHTRNVA

fnr

Fumarate and nitrate reduction regulatory protein

250 amino acids

Global transcription factor that controls the expression of over 100 target genes in response to anoxia. It facilitates the adaptation to anaerobic growth conditions by regulating the expression of gene products that are involved in anaerobic energy metabolism. When the terminal electron acceptor, O(2), is no longer available, it represses the synthesis of enzymes involved in aerobic respiration and increases the synthesis of enzymes required for anaerobic respiration (By similarity).

27.967 kDa

MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENNDALAQLAGHTRNVA

fnr

Fumarate and nitrate reduction regulatory protein

250 amino acids

Global transcription factor that controls the expression of over 100 target genes in response to anoxia. It facilitates the adaptation to anaerobic growth conditions by regulating the expression of gene products that are involved in anaerobic energy metabolism. When the terminal electron acceptor, O(2), is no longer available, it represses the synthesis of enzymes involved in aerobic respiration and increases the synthesis of enzymes required for anaerobic respiration.

27.967 kDa

MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENNDALAQLAGHTRNVA

fnr

Fumarate nitrate reduction regulatory protein

250 amino acids

Global transcription factor that controls the expression of over 100 target genes in response to anoxia. It facilitates the adaptation to anaerobic growth conditions by regulating the expression of gene products that are involved in anaerobic energy metabolism. When the terminal electron acceptor, O(2), is no longer available, it represses the synthesis of enzymes involved in aerobic respiration and increases the synthesis of enzymes required for anaerobic respiration (By similarity).

27.957 kDa

MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGTGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENSDLLAQLAGQARNVA

fnr

Fumarate and nitrate reduction regulatory protein

250 amino acids

Global transcription factor that controls the expression of over 100 target genes in response to anoxia. It facilitates the adaptation to anaerobic growth conditions by regulating the expression of gene products that are involved in anaerobic energy metabolism. When the terminal electron acceptor, O(2), is no longer available, it represses the synthesis of enzymes involved in aerobic respiration and increases the synthesis of enzymes required for anaerobic respiration (By similarity).

27.883 kDa

MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENSDALAALAGHTRNVA

fnr

Fumarate and nitrate reduction regulatory protein

250 amino acids

Global transcription factor that controls the expression of over 100 target genes in response to anoxia. It facilitates the adaptation to anaerobic growth conditions by regulating the expression of gene products that are involved in anaerobic energy metabolism. When the terminal electron acceptor, O(2), is no longer available, it represses the synthesis of enzymes involved in aerobic respiration and increases the synthesis of enzymes required for anaerobic respiration (By similarity).

27.882 kDa

MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGSGHHPSFAQALETSMVCKIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENSDALAALAGHTRNVA

fnr

Fumarate and nitrate reduction regulatory protein

250 amino acids

Global transcription factor that controls the expression of over 100 target genes in response to anoxia. It facilitates the adaptation to anaerobic growth conditions by regulating the expression of gene products that are involved in anaerobic energy metabolism. When the terminal electron acceptor, O(2), is no longer available, it represses the synthesis of enzymes involved in aerobic respiration and increases the synthesis of enzymes required for anaerobic respiration (By similarity).

27.883 kDa

MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENSDALAALAGHTRNVA

fnr

Fumarate and nitrate reduction regulatory protein

250 amino acids

Global transcription factor that controls the expression of over 100 target genes in response to anoxia. It facilitates the adaptation to anaerobic growth conditions by regulating the expression of gene products that are involved in anaerobic energy metabolism. When the terminal electron acceptor, O(2), is no longer available, it represses the synthesis of enzymes involved in aerobic respiration and increases the synthesis of enzymes required for anaerobic respiration (By similarity).

27.914 kDa

MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSCRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENNDALAQLAGHTRNVA

fnr

Fumarate and nitrate reduction regulatory protein

250 amino acids

Global transcription factor that controls the expression of over 100 target genes in response to anoxia. It facilitates the adaptation to anaerobic growth conditions by regulating the expression of gene products that are involved in anaerobic energy metabolism. When the terminal electron acceptor, O(2), is no longer available, it represses the synthesis of enzymes involved in aerobic respiration and increases the synthesis of enzymes required for anaerobic respiration (By similarity).

27.967 kDa

MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENNDALAQLAGHTRNVA

fnr

Fumarate and nitrate reduction regulatory protein

250 amino acids

Global transcription factor that controls the expression of over 100 target genes in response to anoxia. It facilitates the adaptation to anaerobic growth conditions by regulating the expression of gene products that are involved in anaerobic energy metabolism. When the terminal electron acceptor, O(2), is no longer available, it represses the synthesis of enzymes involved in aerobic respiration and increases the synthesis of enzymes required for anaerobic respiration (By similarity).

28.071 kDa

MISEKPAAKRIQSGGCAIHCQDCSISQLCIPFTLNESELDQLDQIIERKKPIQKGQELFKAGDELRSLYAIRSGTIKSYTITEQGDEQITAFHLAGDLVGFDAITGDQHPSFAQALETSMVCEIPYEILDDLSGKMPKLRQQIMRLMSNEIKGDQEMILLLSKKNAEERLAAFLYNLSTRFSQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSEILSVKGKYITILNHAELMELAGVSKESK

fnr

Fumarate and nitrate reduction regulatory protein

250 amino acids

Global transcription factor that controls the expression of over 100 target genes in response to anoxia. It facilitates the adaptation to anaerobic growth conditions by regulating the expression of gene products that are involved in anaerobic energy metabolism. When the terminal electron acceptor, O(2), is no longer available, it represses the synthesis of enzymes involved in aerobic respiration and increases the synthesis of enzymes required for anaerobic respiration (By similarity).

28.071 kDa

MISEKPAAKRIQSGGCAIHCQDCSISQLCIPFTLNESELDQLDQIIERKKPIQKGQELFKAGDELRSLYAIRSGTIKSYTITEQGDEQITAFHLAGDLVGFDAITGDQHPSFAQALETSMVCEIPYEILDDLSGKMPKLRQQIMRLMSNEIKGDQEMILLLSKKNAEERLAAFLYNLSTRFSQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSEILSVKGKYITILNHAELMELAGVSKESK

fnr

Fumarate and nitrate reduction regulatory protein

250 amino acids

Global transcription factor that controls the expression of over 100 target genes in response to anoxia. It facilitates the adaptation to anaerobic growth conditions by regulating the expression of gene products that are involved in anaerobic energy metabolism. When the terminal electron acceptor, O(2), is no longer available, it represses the synthesis of enzymes involved in aerobic respiration and increases the synthesis of enzymes required for anaerobic respiration (By similarity).

28.133 kDa

MIPEKRVIRRIQSGGYAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQALFKAGDELKSLYAIRSGTIKSYTITEEGDEQITGFHLAGDLVGFDAISNLQHPSFAQALETSMVCEIPFDTLDDLSGKMPNLRQQIMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSHRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSNILSVKGKYITIENNEALAQLAGNPKPRL

fnr

Anaerobic regulatory protein

238 amino acids

It is involved in the activation of genes necessary for anaerobic respiration.

27.218 kDa

MNFLSVRPSDSDLISSDLYELLESISTKRKMEKHTYLFREGMDAEELYLIQSGLIEIGKLTSDGKDLTLRICQKHDIVGELTLFTEEPRYMLSAKVLEDGEVLVINKNKLEKELIQNGALTFEFMKWMSTHLRKIQSKIRDLLLHGKKGALYSTLIRLSNSYGVERSDGILINIVLTNQDLAKFCAAARESVNRMLGDLRKKGVISIDESGKIILHKRDYLRCEIECENCPLEICNID

fnr

Anaerobic regulatory protein

92 amino acids

It is involved in the activation of genes necessary for anaerobic respiration.

10.624 kDa

single

CEIPFDILDDLSGKMPKLRQQIMRLMSSEIKSDQEMILLLSKMNAEERLAAFIYNLSQRYSARGFSAREFRLTMTRGDIGNYLGLTVETISR

fnr

Anaerobic regulatory protein

92 amino acids

It is involved in the activation of genes necessary for anaerobic respiration. It probably also activates genes involved in the production of virulence factors.

10.704 kDa

single

CEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLDVFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISR

fnr

Anaerobic regulatory protein

92 amino acids

It is involved in the activation of genes necessary for anaerobic respiration.

10.69 kDa

single

CEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLDVFIYNLSRRFGQRGFSPREFRLTMTRGDIGNYLGLTVETISR