fliN

Flagellar motor switch protein FliN

198 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

19.942 kDa

MAPKKAAPIAEPAVFAADAELDQAIDDLRGVLKKDGAADFGADFAAAGPLEQPMDFGSDFGSTDGAGFGGDFAAGFGGGLTETGAAGGFDAGSGFVGGDFDAAPIVGETAPGSGMTANMDLIMDIPIDVQIVLGTSRMQVSGLMALTEGATIALDRKIGEPVEIMVNGRVIGRGEITVLEGDVTRFGVKLLEIKGTKK

fliN

Flagellar motor switch protein FliN

198 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

19.942 kDa

MAPKKAAPIAEPAVFAADAELDQAIDDLRGVLKKDGAADFGADFAAAGPLEQPMDFGSDFGSTDGAGFGGDFAAGFGGGLTETGAAGGFDAGSGFVGGDFDAAPIVGETAPGSGMTANMDLIMDIPIDVQIVLGTSRMQVSGLMALTEGATIALDRKIGEPVEIMVNGRVIGRGEITVLEGDVTRFGVKLLEIKGTKK

fliN

Flagellar motor switch protein FliN

179 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

18.803 kDa

MATKKTPVTDDAALPSFEDGVDLDQAIGDLRGVLKTDAEGSLSDFGDFGDFGSTDEVSTDNDLSAFGGGAADFAMDDFAAAPQVAGVKAPLGSGLSENMEMIMDIPIDVQIVLGTSRMLVSGLMSLEEGATIALDRKIGEPVEIMVNGRRIARGEITVLEDDDTRFGVKLIEVLSTRKA

fliN

Flagellar motor switch protein FliN

179 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

18.803 kDa

MATKKTPVTDDAALPSFEDGVDLDQAIGDLRGVLKTDAEGSLSDFGDFGDFGSTDEVSTDNDLSAFGGGAADFAMDDFAAAPQVAGVKAPLGSGLSENMEMIMDIPIDVQIVLGTSRMLVSGLMSLEEGATIALDRKIGEPVEIMVNGRRIARGEITVLEDDDTRFGVKLIEVLSTRKA

fliN

Flagellar motor switch protein FliN

157 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

16.62 kDa

MADEEKVTTEEQALADEWAAALAEAGDASQDDIDALMAQGGATPVAEPSTPRAPMEEFGASPKAPTISGLEGPNLDVILDIPVTISMEVGHTDISIRNLLQLNQGSVIELDRLAGEPLDVLVNGTLIAHGEVVVVNEKFGIRLTDVISPSERIKKLR

fliN

Flagellar motor switch protein FliN

157 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

16.62 kDa

MADEEKVTTEEQALADEWAAALAEAGDASQDDIDALMAQGGATPVAEPSTPRAPMEEFGASPKAPTISGLEGPNLDVILDIPVTISMEVGHTDISIRNLLQLNQGSVIELDRLAGEPLDVLVNGTLIAHGEVVVVNEKFGIRLTDVISPSERIKKLR

fliN

Flagellar motor switch protein FliN

137 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form a switch complex that is proposed to be located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation.

Belongs to the FliN/MopA/SpaO family.

14.855 kDa

MSDMNNPADDNNGAMDDLWAEALSEQKSTSSKSAAETVFQQFGGGDVSGTLQDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLSR

fliN

Flagellar motor switch protein FliN

137 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

14.789 kDa

MSDMNNPSDENTGALDDLWADALNEQKATTTKSAADAVFQQLGGGDVSGAMQDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLSR

fliN

Flagellar motor switch protein FliN

137 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form a switch complex that is proposed to be located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation.

Belongs to the FliN/MopA/SpaO family.

14.855 kDa

MSDMNNPADDNNGAMDDLWAEALSEQKSTSSKSAAETVFQQFGGGDVSGTLQDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLSR

fliN

Flagellar motor switch protein FliN

137 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

14.789 kDa

MSDMNNPSDENTGALDDLWADALNEQKATTTKSAADAVFQQLGGGDVSGAMQDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLSR

fliN

Flagellar motor switch protein FliN

134 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

15.13 kDa

MDNILVNNKNKNLLDLNKEDIKKSCEIEDKIFHSKTVNDVDLNLNSKNDISSKMKFIMDVPVHLTIEVGTVKITIKDLLELRSKSILVLDKHAGDPLNILVNGYVIATGELVVTENKYGIRIINIIDNSVFKKL

fliN

Flagellar motor switch protein FliN

134 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

15.13 kDa

MDNILVNNKNKNLLDLNKEDIKKSCEIEDKIFHSKTVNDVDLNLNSKNDISSKMKFIMDVPVHLTIEVGTVKITIKDLLELRSKSILVLDKHAGDPLNILVNGYVIATGELVVTENKYGIRIINIIDNSVFKKL

fliN

Flagellar motor switch protein FliN

133 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

14.898 kDa

MSKIQKNSDNDKLIDSEKKIPTDQDVDKNLLPQENSKNSTLDNTIDIVDSKKTILNVPVNITVELGTSRIKIKDFLKFSKGSMLILNESIKEPLNIFMNGHLIASGEIVVLEEKYGIRITNIKNSLKTINISS

fliN

Flagellar motor switch protein FliN

133 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

15.403 kDa

MKKVEKKDNFKKFKNDNIYKKDDKNINQELINEEKKIKNFNSSNNESSNEKKILFDIEMNITVELGKSKVKIKDLLNFSKGSMLFLQRKKEDPLKVFANNKLIALGEIVFSNNKYGIRIISINNSLNGINTSV

fliN

Flagellar motor switch protein FliN

133 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

14.898 kDa

MSKIQKNSDNDKLIDSEKKIPTDQDVDKNLLPQENSKNSTLDNTIDIVDSKKTILNVPVNITVELGTSRIKIKDFLKFSKGSMLILNESIKEPLNIFMNGHLIASGEIVVLEEKYGIRITNIKNSLKTINISS

fliN

Flagellar motor switch protein FliN

133 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

15.403 kDa

MKKVEKKDNFKKFKNDNIYKKDDKNINQELINEEKKIKNFNSSNNESSNEKKILFDIEMNITVELGKSKVKIKDLLNFSKGSMLFLQRKKEDPLKVFANNKLIALGEIVFSNNKYGIRIISINNSLNGINTSV

fliN

Flagellar motor switch protein FliN

113 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

12.305 kDa

MSVDEKSDNGEKPEIKGVKLPDLIDTLPEGVDPSNFGLLMDVSMQLTVELGRTERKIKDILGMSEGTIITLDKLAGEPVDILVNGKIVAKGEVVVIDENFGVRITEIIKTKNE

fliN

Flagellar motor switch protein FliN

113 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

12.305 kDa

MSVDEKSDNGEKPEIKGVKLPDLIDTLPEGVDPSNFGLLMDVSMQLTVELGRTERKIKDILGMSEGTIITLDKLAGEPVDILVNGKIVAKGEVVVIDENFGVRITEIIKTKNE

fliN

Flagellar motor switch protein FliN

112 amino acids

FliM is one of 2 proteins (FliG, FliN) that might form a switch complex that is proposed to be located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (Potential).

Belongs to the FliN/MopA/SpaO family.

12.672 kDa

MEEQTKEIQEEKKETPQEEVREEKKEEKKVSVIELIQHFSDIPVEVEVVVGRANKTLGELLAMGIGSVIEIDREPKDLVDIKVNGKLIAKGELVIIDGKIGVKIKEVVKEQR

fliN

Flagellar motor switch protein FliN

112 amino acids

FliM is one of 2 proteins (FliG, FliN) that might form a switch complex that is proposed to be located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (Potential).

Belongs to the FliN/MopA/SpaO family.

12.672 kDa

MEEQTKEIQEEKKETPQEEVREEKKEEKKVSVIELIQHFSDIPVEVEVVVGRANKTLGELLAMGIGSVIEIDREPKDLVDIKVNGKLIAKGELVIIDGKIGVKIKEVVKEQR

fliN

Flagellar motor switch protein FliN

110 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

11.668 kDa

MAEDNLTLDEFGGAMLASEAPIELSDKTAADLAPVFDVPVNISAVLGRANMSVAQLLQLGQGSILELDRKVGEAIDIYVNNRLVARGEVVVVDERLGVTMTEIIKDGDQG

fliN

Flagellar motor switch protein FliN

110 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

11.668 kDa

MAEDNLTLDEFGGAMLASEAPIELSDKTAADLAPVFDVPVNISAVLGRANMSVAQLLQLGQGSILELDRKVGEAIDIYVNNRLVARGEVVVVDERLGVTMTEIIKDGDQG

fliN

Flagellar motor switch protein FliN

106 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

11.623 kDa

single

RPTTEGIFKSLDGHDPLGALQDIDLILDIPVKLTVELGRTKMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVSDKYGVRITDIITPSERMRRLSR

fliN

Flagellar motor switch protein FliN

106 amino acids

FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).

Belongs to the FliN/MopA/SpaO family.

11.623 kDa

single

RPTTEGIFKSLDGHDPLGALQDIDLILDIPVKLTVELGRTKMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVSDKYGVRITDIITPSERMRRLSR