FEZF1

Fez family zinc finger protein 1

475 amino acids

Transcription repressor. Involved in the axonal projection and proper termination of olfactory sensory neurons (OSN). Plays a role in rostro-caudal patterning of the diencephalon and in prethalamic formation. Expression is required in OSN to cell-autonomously regulate OSN axon projections. Regulates non-cell-autonomously the layer formation of the olfactory bulb development and the interneurons. May be required for correct rostral migration of the interneuron progenitors (By similarity).

Belongs to the krueppel C2H2-type zinc-finger protein family.

52.038 kDa

MDSSCHNATTKMLATAPARGNMMSTSKPLAFSIERIMARTPEPKALPVPHFLQGALPKGEPKHSLHLNSSIPCMIPFVPVAYDTSPKAGVTGSEPRKASLEAPAAPAAVPSAPAFSCSDLLNCALSLKGDLARDALPLQQYKLVRPRVVNHSSFHAMGALCYLNRGDGPCHPAAGVNIHPVASYFLSSPLHPQPKTYLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLHDSSLGLARTPAGEPGTEPPPPLPQQPPMTLPPLQPPLPTPGPLQPGLHQGHQ

Fezf1

Fez family zinc finger protein 1

475 amino acids

Transcription repressor. Involved in the axonal projection and proper termination of olfactory sensory neurons (OSN). Plays a role in rostro-caudal patterning of the diencephalon and in prethalamic formation. Expression is required in OSN to cell-autonomously regulate OSN axon projections. Regulates non-cell-autonomously the layer formation of the olfactory bulb development and the interneurons. May be required for correct rostral migration of the interneuron progenitors.

Belongs to the krueppel C2H2-type zinc-finger protein family.

52.006 kDa

MDSSCLNATTKMLATAPARGNVMSTSKPLAFSIERIMARTPEPKALPVPHFLQGAVPKGDPKHSLHLNSSIPCMIPFVPVAYDTNSKAGVNGSEPRKASLEVPAPPAVAPSAPAFSCSDLLNCALSLKGDLARDALPLQQYKLVRPRVVNHSSFHAMGALCYLNRGDGPCHPAASVNIHPVASYFLSSPLHPQPKTYLAERNKLVVPAVEKLPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLHDSSLGLTRTPTGEPSSDPPPQLQQPPPAPLPPLQPTLPPPGPLPSGLHQGHQ

fezf1

Fez family zinc finger protein 1

466 amino acids

Transcription repressor. Involved in the development of the forebrain region.

Belongs to the krueppel C2H2-type zinc-finger protein family.

52.01 kDa

MDSSLQHSTTKILSTQESREALSNRLTMISGAKPLAFSIERIMSRTPEPKCLPVASLLQSSAPKGDQKPGLHINSSSIPRMIPFVPVAYEHCAKIGISGAELRKSHVDSSPPFSCSDLLNCALTLKGDFPREALPLQQYKLVRPRVVNHSSFHAMGAAFCYFNRGDSEWHPPASINIHPMASYFLGSPLHQAPKCYVAAERNKLLAPSVEKFPSGVTFKDLSQAQFQHYMKEGPRSLSDKITFKTSAKFSSASPSSKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKICGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQIYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLHDNSGSSAGTRGLGATGHQELHLPNREQSHTIIQSPQLQKSVY

fezf1

Fez family zinc finger protein 1

462 amino acids

Transcription repressor. Involved in the development of the forebrain region (By similarity).

Belongs to the krueppel C2H2-type zinc-finger protein family.

51.493 kDa

MDSSLQHKTTKIFPSQASRDSLSNRVTMISGAKPLAFSIERIMSRTPEPKCLPVPSLLQGSVPKGDQKQALHINSSSIPCMIPFVPVAYDHCPKIGISGAELRKSHLDSSPPFSCNDLLNCALTLKGDFPREALPLQQYKLVRPRVVNHSSFHAMGAAFCYFNRGDSQCHPPASINIHPVASYFLGSPLHQAPKSYLAERNKLVLPSVEKFSSGVTFKDLSQAQFQHYMKEGAHSLSDKITFKTSAKFSSASPSNKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKICGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQIYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLHDSNTAAPHAIGGTGQEELLLPNREPSPTIQSPQLQKSGY

fezf1

Fez family zinc finger protein 1

429 amino acids

Transcription repressor. Involved in the development of the forebrain region (By similarity).

Belongs to the krueppel C2H2-type zinc-finger protein family.

47.395 kDa

MDSALYHSAGIFGAPSASTGGSMIASSKPLAFSIERIMARTPEPKSIPFPNLFQAPVGKAEPKQSPAPLHCMIPLMPLACEPPHKLHINGLDHPDTFAYNANELLSIGLNYKNEQQDAAPAIGQYKLFRPRVVNQSSFHAMGAAVCYLNCGEGACPPHAGLVNLHPMASYLLNTPLHARQKSLFSSEKSKQGAVADRCPPGVSFKELSHSHLHHYMKESAHILSEKLFKNSAAKVNSGSPQTKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFICEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHIRKLHDISPGPHSPPTPTGNTEGQ