fdxH

Formate dehydrogenase iron-sulfur subunit

312 amino acids

Allows to use formate as major electron donor during aerobic respiration. The beta chain is an electron transfer unit containing 4 cysteine clusters involved in the formation of iron-sulfur centers. Electrons are transferred from the gamma chain to the molybdenum cofactor of the alpha subunit (By similarity).

34.069 kDa

MAGTAQGVQTQDVIKISATSGLTPAPQARDHKVEIAKLIDVSTCIGCKACQVGCSEWNDIRSDINAQCVGVYDNPVDLDAKAWTVMRFNEVEENDRLEWLIRKDGCMHCTEPGCLKACPAPGAIIQYANGIVDFQSDKCIGCGYCIAGCPFNIPRMNPEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIRFGSKEEMKIYAEQRVADLKSRGYENAGLYDPPGVGGTHVMYVLHHADKPELYNGLPKDPQIDLSVTLWKDVLKPVAAVAMGGLALAEVAHYLTVGPNVEEDVEDHHHEFEENKPSKGENNE

fdxH

Ferredoxin, heterocyst

99 amino acids

Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.

Belongs to the 2Fe2S plant-type ferredoxin family.

10.95 kDa

MATYQVRLINKKEDLDSTIEIDEDTTILEGAAENGIELPFSCHSGSCSSCVGKVVEGEVDQSDQIFLDDEQMSKGFALLCVTYPRSNCTIKTHQEPYLV

fdxH

Ferredoxin, heterocyst

99 amino acids

Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. Donates electrons to the nitrogenase.

Belongs to the 2Fe2S plant-type ferredoxin family.

10.949 kDa

MASYQVRLINKKQDIDTTIEIDEETTILDGAEENGIELPFSCHSGSCSSCVGKVVEGEVDQSDQIFLDDEQMGKGFALLCVTYPRSNCTIKTHQEPYLA