fabH1

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

355 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

37.173 kDa

MSKIKARKGAPYARILGVGGYRPVRVVPNDVILEKIDSSDEWIRSRSGIETRHWASDEETVAAMSIEASGKAIADAGITASQIGAVVVSTVSHFSQTPAIATEIADKLGTNKAAAFDISAGCAGFGYGLTLAKGMVVEGSAEYVLVIGVERLSDLTDLEDRATAFLFGDGAGAVVVGPSEEPHIGPTVWGSEGDKAGTIKQTVPWDRYLPHSRLRSSGGTPTGDVSPLPLDSEGNVKFPAITQEGQAVFRWAVFEMAKVAQQALDAAGITSDDLDVFIPHQANERIIDSMVKTLKLPEHVTVARDVRTTGNTSAASIPLAMERLLATGEAKSGDTALVIGFGAGLVYAATVVTLP

fabH1

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

343 amino acids

Essential enzyme that catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

35.982 kDa

MSKIKPSKGAPYARILGVGGYRPTRVVPNEVILEKIDSSDEWIRSRSGIETRHWAGPEETVAAMSVEASGKALADAGIDASRIGAVVVSTVSHFSQTPAIATEIADRLGTDKAAAFDISAGCAGFGYGLTLAKGMVVEGSAEYVLVIGVERLSDLTDLEDRATAFLFGDGAGAVVVGPSQEPAIGPTVWGSEGDKAETIKQTVSWDRFRIGDVSELPLDSEGNVKFPAITQEGQAVFRWAVFEMAKVAQQALDAAGISPDDLDVFIPHQANVRIIDSMVKTLKLPEHVTVARDIRTTGNTSAASIPLAMERLLATGDARSGDTALVIGFGAGLVYAATVVTLP

fabH1

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

341 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

36.031 kDa

MKSIGITAIGMYVPERVVHNHEFESRMGIEDGWIESRSGIRERRFSAPGEFASHIGAKAVQDMLARDPDALKDVDLVIYATCTPDAMFPSTAALVAGQVGLTGVGAYDLSTACSGFVYALSMARGMILGGSAKNVLVLGGEVLSKALDQDDRDTAILFGDGCGCAVVGEVPAGYGFQDFVLGADSAGGPALYISNLADQFPDGQIMRGVPTMNGREVFKFAVRVLGDSGTQALQKSGLSNADVDWLIPHQANIRIIEAATQRFGIPMEKTVINLDRYGNTSAGTVPLALYEAVNDGRIQGGQQLLMVVFGGGLSWAACTMKWWGGRPSLHAQVAQPAEVPA

fabH1

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

335 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

37.22 kDa

MDKINAVITGVGGYVPDYVLTNDEISKMVDTTDEWIMGRIGIKERHILNEEGLGTSYMARKAAKQLMQRTKSRPDDIDLVIVATTTSDYRFPSTASILCERLGLKNAFAFDMQAVCSGFLYAMETGANFIRSGKYKKIIIVGADKMSSVIDYTDRATCPIFGDGAAAFMLEPTTEEVGIMDSVLRTDGKGLPFLHIKAGGSVCPPSYYSLDHHLHYIYQEGRTVFKYAVANMSDSCEAIIARNHLTKEEVDWVIPHQANQRIITAVAQRLEVPSEKVMVNIERYGNTSAGTLPLCIWDFEKKLKKGDNLIFTAFGAGFAWGAVYVKWGYDPKEDA

fabH1

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

323 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

34.391 kDa

MPTYTKLTAMGQYVPGRVVDNDELAAIMDTSDEWIQAHTGIKTRHYAMNDENTSDLATQVAQQLLQKSGLAASAIDLILVTTITPDALTPATACLVQANIGADNAFAFDLSAACAGFTFGLATADKFIRSGQYQNVMVISAEVNSKMMDFQDRTAAVFFGDGAGGALLQATDNPDENSLIAEKLESQGNATVIHSGRVRPITEVAATNYPQTDAFYQVGRDVFQFATTVVPEQMRGLIASAQLTPSDLQYVICHQANLRIIEKIAANLALPMTKFPHNVDHYGNTSSAGVAMALANVFDTLTGPVLLTAFGGGLAYGSVLIKK

fabH1

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

316 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

33.749 kDa

MYSKILGTGSYLPSQVRTNADLEKMVETSDEWIVARTGIRERRIAADNETVADMAFFAAQNAINMAGIDKHDIDMIIVATTSASHTFPSAACQVQGKLGIKGCPAFDLAAACSGFMYALSIADQHVKSGMCKHVLVIGADALSKTCDPTDRSTIILFGDGAGAVVVGASNEPGILSTHIHADGEFGDLLSLEVPVRGGDSDKWLHMAGNEVFKVAVTQLSKLVVDTLKANNMHKSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDRHGNTSAATVPTALDEAVRDGRIQRGQMLLLEAFGGGFTWGSALVKF

fabH1

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

316 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

33.797 kDa

MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVARTGIKERRIAAEDETVADMAFYAAENAIDMAGIDKNDIDLIIVATTSSSHTFPSSACQVQAKLGIKGCPAFDLAAACSGFVYALSVADQHIKSGMCKNVLVIGADALSKTCDPTDRSTIILFGDGAGAVVVGASQEPGIISTHIYADGQFGDLLSLPVPERGKDVDKWLHMAGNEVFKVAVTQLSKLVKDTLEANDMHKSELDWLVPHQANYRIISATAKKLSMSLDQVVVTLDRHGNTSAATVPTALDEAVRDGRIKRGQTLLLEAFGGGFTWGSALVKF

fabH1

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

316 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

33.856 kDa

MYSKILGTGSYLPSQIRTNADLEKMVETSDEWIVARTGIKERRIAAENETVADMGFYAAQNAIEMAGIDKNDIDLIIVATTSGSHTFPSSACQVQAKLGIKGCPAFARAAACSGFVYALSIADQHIKTGMCKNVLVIGSDTLSKTCDPTDRSTIILFGDGAGAVVVGASEEPGILSTHIYADGEFGDLLSLEVPERGKDADKWLHMAGNEVFKVAVTQLSKLVKDTLEANGMHKSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDRHGNTSAATVPTALDEAVRDGRIQRGQTLLLEAFGGGFTWGSALVRF

fabH1

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

316 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

33.857 kDa

MYSKILGTGSYLPSQIRTNADLEKMVETSDEWIVARTGIKERRIAAENETVADMGFYAAQNAIEMAGIDKNDIDLIIVATTSGSHTFPSSACQVQAKLGIKGCPAFDLAAACSGFVYALSIADQHIKTGMCKNVLVIGSDTLSKTCDPTDRSTIILFGDGAGAVVVGASEEPGILSTHIYADGEFGDLLSLEVPERGKDADKWLHMAGNEVFKVAVTQLSKLVKDTLEANGMHKSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDRHGNTSAATVPTALDEAVRDGRIQRGQTLLLEAFGGGFTWGSALVRF

fabH1

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

313 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

33.982 kDa

MNVGIKGFGAYAPKNIIDNAYFEQFLETSDEWISKMTGIKERHWADEDQDTSDLAYNASIKAIEDAGIQPVDIDMIIVATATGDMPFPSVANILQERLGTGKVATMDQLAACSGFMYSMITAKQYIQSGDYKHILVVGADKLSKITDMTDRSTAVLFGDGAGAVVMGEVAEGRGIISYEMGSDGSGGKYLYLDRETGKLKMNGREVFKFAVRIMGDASTRVVEKAGLSSEDIDLFVPHQANIRIMESARERLGIEREKMSVSVNKYGNTSAASIPLSINQELQNGKIKDDDTLVLVGFGGGLTWGAIVIKWGK

fabH1

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

312 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

33.626 kDa

MTRAGILGIGSYVGEHVVTNKDFEKRIDTSDEWIRTRTGIEERRFAPDNVDTSDMAYEASVKALKAAGVSAEEIDLILVATVTPDMPFPTVSTLVQQRLGAKKAAAMDISAACAGFIYGLATGQQFIENGGYKHVLVIGVEKLSKITDMTDRNTAVLFGDGAGAAVMGAVSEDRGILAYELGADGEGAMHINQKGEYIQMNGREVFKFAVRQMGESALSVLEKAGLSKEDVDFLIPHQANIRIMEASRERLELPVEKMSTTVKKYGNTSSASIPMAMVDELKDGKIKDGDLLVLVGFGAGLVWGSLALRWGR

fabH1

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

310 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

33.453 kDa

MNVGILGIGRYVPEKVVTNHDLEKIMDTSDEWIRTRTGIAERRIADDTIDTSYMAVEASKKALEDAGISGEDIDLILVATVTPDRAFPAVACVIQEAIGAKHAAAMDLSAACAGFMYGMITAQQFIQTGTYKNVLVVGSDKLSKIVDWNDRNTAVLFGDGAGAIVMGAVSEGKGVLSFELGADGSGGKHLYQDEYVMMNGREVFKFAVRQLGDSCLRVLDKAGLTKEDVDFLVPHQANIRIMESARERLNLPQEKMSMTIEKFGNTSASSIPIAMVEELQNGRIQDGDLIILVGFGGGLTWGAVALRWGK

fabH1

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

310 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

33.453 kDa

MNVGILGIGRYVPEKVVTNHDLEKIMETSDEWIRTRTGIAERRIADDTIDTSYMAVEASKKALEDAGISGEDIDLILVATVTPDRAFPAVACVIQEAIGAKHAAAMDLSAACAGFMYGMITAQQFIQTGTYKNVLVVGSDKLSKIVDWNDRNTAVLFGDGAGAVVMGAVSEGKGVLSFELGADGSGGKHLYQDEYVMMNGREVFKFAVRQLGDSCLRVLDKAGLTKEDVDFLVPHQANIRIMESARERLNLPQEKMSMTIEKFGNTSASSIPIAMVEELQNGRIQDGDLIILVGFGGGLTWGAVALRWGK