esr1

Estrogen receptor

622 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

68.084 kDa

MLVRQSHTQISKPLGAPLRSRTTLESHVISPPKLSPQQPTTPNSNMYPEETRGGGGAAAFNYLDGGYDYTAPAQGPAPLYYSTTPQDAHGPPSDGSMQSLGSSPTGPLVFVSSSPQLSPQLSPFLHPPSHHGLPSQSYYLETSSTPLYRSSVVTNQLSASEEKLCIASDRQQSYSAAGSGVRVFEMANETRYCAVCSDFASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTMDRNRRKSCQACRLRKCYEVGMVKGGLRKDRGGRVLRKDKRYCGPAGDREKPYGDLEHRTAPPQDGGRNSSSSLNGGGGWRGPRITMPPEQVLFLLQGAEPPALCSRQKVARPYTEVTMMTLLTSMADKELVHMIAWAKKVPGFQELSLHDQVQLLESSWLEVLMIGLIWRSIHCPGKLIFAQDLILDRSEGDCVEGMAEIFDMLLATVSRFRMLKLKPEEFVCLKAIILLNSGAFSFCSNSVESLHNSSAVESMLDNITDALIHHISHSGASVQQQPRRQAQLLLLLSHIRHMSNKGMEHLYSIKCKNKVPLYDLLLEMLDGHRLQSPGKVAQAGEQTEGPSTTTTTSTGSSIGPMRGSQDTHIRSPGSGVLQYGSPSSDQMPIP

esr1

Estrogen receptor

620 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

67.729 kDa

MSKRQSSVQIRQLFGPALRSRISPASSELETLSPPRLSPRDPLGDMYPEESRGSGGVAAVDFLEGTYDYAAPNPATTPLYSQSSTGYYSAPLETNGPPSEGSLQSLGSGPTSPLVFVPSSPRLSPFMHPPSHHYLETTSTPVYRSSHQGASREDQCGSREDTCSLGELGAGAGAGGFEMAKDTRFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDRNRRKSCQACRLRKCYEVGMMKGGVRKDRIRILRRDKRRTGVGDGDKVVKGQEHKTVHYDGRKRSSTGGGGGGGGGRLSVTSIPPEQVLLLLQGAEPPILCSRQKLSRPYTEVTMMTLLTSMADKELVHMIAWAKKLPGFLQLSLHDQVLLLESSWLEVLMIGLIWRSIHCPGKLIFAQDLILDRNEGDCVEGMTEIFDMLLATASRFRVLKLKPEEFVCLKAIILLNSGAFSFCTGTMEPLHNSAAVQSMLDTITDALIHYISQSGYLAQEQARRQAQLLLLLSHIRHMSNKGMEHLYSMKCKNKVPLYDLLLEMLDAHRLHHPVRAPQSLSQVDRDPPSTSSGGGGIAPGSISASRGRIESPSRGPFAPSVLQYGGSRPDCTPALQD

esr1

Estrogen receptor

617 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

67.671 kDa

MSEEQARAEAPAGARQRRRSELEGYSVSLASLKLSPMYPEEEQRTTGGISSTAHYLDGTFNYTTNPDATNSSVDYYSVAPEPQEENLQPLPNGSSSPPVFVPSSPQLSPFLGHPPAGQHTAQQVPYYLEPSGTSIYRSSVLASAGSRVELCSAPGRQDVYTAVGASGPSGASGPSGAIGLVKEIRYCSVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYVCPATNQCTIDRNRRKSCQACRLRKCYEVGMMKGGFRKERGGRIIKHNRRPSGLKERERGYSKAQSGSDVREALPQDGQSSSGIGGGVADVVCMSPEQVLLLLLRAEPPTLCSRQKHSRPYSELTIMSLLTNMADRELVHMIAWAKKVPGFQDLSLHDQVQLLESSWLEILMIGLIWRSIYTPGKLIFAQDLILDKSEGECVEGMAEIFDMLLATVARFRTLKLKSEEFVCLKAIILLNSGAFSFCSSPVEPLRDGFMVQCMMDNITDALIYYISQSGISVQLQSRRQAQLLLLLSHIRHMSYKGMEHLYSMKCKNKVPLYDLLLEMLDAHRLRPLGKVPRIWADRVSSSPTTTATTPTTNTTTTTTTTTHHPSNGSTCPADLPSNPPGPGQSPSP

Esr1

Estrogen receptor

600 amino acids

Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3 (By similarity).

Belongs to the nuclear hormone receptor family. NR3 subfamily.

67.03 kDa

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPAVFNYPEGAAYEFNAAAAAAAAGASAPVYGQSSITYGPGSEAAAFGANSLGAFPQLNSVSPSPLMLLHPPPHVSPFLHPHGHQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSSEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGTSGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPLIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKINDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQSQLTTTSSTSAHSLQTYYIPPEAEGFPNTI

Esr1

Estrogen receptor

599 amino acids

Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

66.955 kDa

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI

ESR1

Estrogen receptor

596 amino acids

Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3 (By similarity).

Belongs to the nuclear hormone receptor family. NR3 subfamily.

66.489 kDa

MTMTLHTKASGMALLHQIQANELEPLNRPQLKIPLERPLGEVYMDSSKPAVYNYPEGAAYDFNAAAPASAPVYGQSGLPYGPGSEAAAFGANGLGAFPPLNSVSPSPLVLLHPPPQPLSPFLHPHGQQVPYYLENESSGYAVREAGPPAYYRPNSDNRRQGGRERLASTSDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRNEAVPSGDMRAANLWPSPIMIKHTKKNSPVLSLTADQMISALLEAEPPIIYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLALHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLRSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHFRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPANFGSAPPEDVNQSQLAPTGCTSSHSLQTYYITGEAENFPSTV

ESR1

Estrogen receptor

595 amino acids

Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades.Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3 (By similarity).

Belongs to the nuclear hormone receptor family. NR3 subfamily.

66.361 kDa

MTMTLHTKASGMALLHQIQANELEPLNRPQLKIPLERPLGEVYVDSSKPAVYNYPEGAAYDFNAAAAASAPVYGQSGLAYGPGSEAAAFGANGLGGFQPLNSVSPSPLVLLHPPPQLSPFLHPHGQQVPYYLENEPSGYAVREAGPPAFYRPNSDNRRQGGRERLASTSDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRNEAVPPGDMRSANLWPSPLLIKHTKKNSPVLSLTADQMISALLEAEPPIIYSEYDPTRPLSEASMMGLLTNLADRELVHMINWAKRVPGFLDLSLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHFRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPTNLGGPPPEDMSQSQLATSGSTPSHSLQMYYITGEAENFPTTI

ESR1

Estrogen receptor

595 amino acids

Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades.Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3 (By similarity).

Belongs to the nuclear hormone receptor family. NR3 subfamily.

66.05 kDa

MTMTLHTKASGMALLHQIQGNELETLNRPQLKIPLERPLGEVYVDGSKPAVYNYPEGAAYDFNAAAAASAPVYGQSGLAYGSGSEAAAFGANGLGGFPPLNSVSPSPLVLLHPPPQLSPFLHPHGQQVPYYLENEPSGYAVREAGPPAFYRPTSDNRRQSGRERLASTGDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDEGEGRNEVGSSGDVRASNLWPSPLLIKHTKKNSPALSLTADQMVSALLEAEPPIIYSDYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLSLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLSLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPANRGGAPMEEMNQSQLATTGSTSAHSLQAYYITEEAGAFPTTV

ESR1

Estrogen receptor

595 amino acids

Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Isoform 3 is involved in activation of NOS3 and endothelial nitric oxide production. Isoforms lacking one or several functional domains are thought to modulate transcriptional activity by competitive ligand or DNA binding and/or heterodimerization with the full-length receptor. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3. Isoform 3 can bind to ERE and inhibit isoform 1.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

66.216 kDa

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV

ESR1

Estrogen receptor

595 amino acids

Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3 (By similarity).

Belongs to the nuclear hormone receptor family. NR3 subfamily.

66.834 kDa

MTMTLHTKASGMALLHQIQGNELEPLSRPQLKMPLERALSEVYVDSSKPAMFNYPEGAAYEFNAATAPAPVYGQTGIAYGSGSEATAFGSNSLGLFPQLNSVSPSPLMLLHPPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDSGPPAFYRSNSDNRRQSGRERLSSSSEKGSMAMESVKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNDMGPSGDMRATNLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPLIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLIWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSARFRMMDLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPFYDLLLEMLDAHRLHTPVSRMGVSPEEPSQSQLTTTNSTSSHSLQTYYIPSEAESFPNTI

ESR1

Estrogen receptor

594 amino acids

Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades.Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3 (By similarity).

Belongs to the nuclear hormone receptor family. NR3 subfamily.

66.104 kDa

MTMTLHTKASGMALLHQIQGNELETLNLPQFKIPLERPLGEVYVESSKPPVYDYPEGAAYDFNAAAAASASVYGQSGLAYGPGSEAAAFGANGLGGFPPLNSVSPSQLMLLHPPPQLSPYLHPPGQQVPYYLENEPSGYSVCEAGPQAFYRPNADNRRQGGRERLASSGDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRNEAGPSGDRRPANFWPSPLLIKHTKKISPVLSLTAEQMISALLDAEPPVLYSEYDATRPFNEASMMGLLTNLADRELVHMINWAKRVPGFVDLSLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRLRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKMTDTLIHLMAKAGLTLQQHRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPANHGGAPMEETNQSQLATTGSTSPHSMQTYYITGEAEGFPNTI

ESR1

Estrogen receptor

589 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

66.746 kDa

MTMTLHTKASGVTLLHQIQGTELETLSRPQLKIPLERSLSDMYVESNKTGVFNYPEGATYDFGTTAPVYGSTTLSYAPTSESFGSSSLAGFHSLNNVPPSPVVFLQTAPQLSPFIHHHSQQVPYYLENEQGSFGMREAAPPAFYRPSSDNRRHSIRERMSSTNEKGSLSMESTKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGEMMKQKRQREEQDSRNGEASSTELRAPTLWTSPLVVKHNKKNSPALSLTAEQMVSALLEAEPPIVYSEYDPNRPFNEASMMTLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATAARFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEERDYIHRVLDKITDTLIHLMAKSGLSLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPAARSAAPMEEENRNQLTTAPASSHSLQSFYINSKEEESMQNTI

ESR1

Estrogen receptor

587 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

66.553 kDa

MTLHTKTSGVTLLHQIQGTELETLSRPQLKIPLERSLSDMYVETNKTGVFNYPEGATYDFGTTAPVYSSTTLSYAPTSESFGSSSLAGFHSLNSVPPSPVVFLQTAPHWSPFIHHHSQQVPYYLENDQGSFGMREAAPPAFYRPNSDNRRHSIRERMSSANEKGSLSMESTKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRVMKQKRQREEQDSRNGEASSTELRAPTLWASPLVVKHNKKNSPALSLTAEQMVSALLEAEPPLVYSEYDPNRPFNEASMMTLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATAARFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDYIHRVLDKITDTLIHLMAKSGLSLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPAARSAAPMEEENRSQLTTASASSHSLQSFYINSKEEENMQNTL

esr1

Estrogen receptor

586 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

66.081 kDa

MTMPLPNKTTGVTFLHQIQSSELETLTRPPLKISLERPLGEMYVENNRTGIFNYPEGTTYDFAAAAAPVYSSASLSYAASSETFGSSSLTGLHTLNNVPPSPVVFLAKLPQLSPFIHHHGQQVPYYLESEQGTFAVREAAPPTFYRSSSDNRRQSGRERMSSANDKGPPSMESTKETRYCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRLLKHKRQKEEQEQKNDVDPSEIRTASIWVNPSVKSMKLSPVLSLTAEQLISALMEAEAPIVYSEHDSTKPLSEASMMTLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMVGLIWRSVEHPGKLSFAPNLLLDRNQGRCVEGLVEIFDMLVTTATRFRMMRLRGEEFICLKSIILLNSGVYTFLSSTLESLEDTDLIHIILDKIIDTLVHFMAKSGLSLQQQQRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRIHTPKDKTTTQEEDSRSPPTTTVNGASPCLQPYYTNTEEVSLQSTV

esr1

Estrogen receptor

585 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

64.166 kDa

MYPEESRGSGGVATVDFLEGTYDYAAPTPAPTPLYSHSTTGCYSAPLDAHGPLSDGSLQSLGSGPTSPLVFVPSSPRLSPFMHPPSHHYLETTSTPVYRSSHQPVPREDQCGTRDEAYSVGELGAGAGGFEMTKDTRFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGMRKDRGRVLRREKRRACDRDKPAKDLPHTRASPQDGRKRAMSSSSTSGGGGRSSLNNMPPDQVLLLLQGAEPPILSSRQKMSRPYTEVTIMTLLTSMADKELVHMITWAKKLPGFLQLSLHDQVLLLESSWLEVLMIGLIWRSIQCPGKLIFAQDLILDRNEGTCVEGMAEIFDMLLATASRFRVLKLKPEEFVCLKAIILLNSGAFSFCTGTMEPLHDSAAVQHMLDTITDALIFHISHLGCSAQQQSRRQAQLLLLLSHIRHMSNKGMEHLYSMKCKNKVPLYDLLLEMLDAHRIHRPVKPFQSWSQGDRDSPTASSTSSSGGGGGDDEGASSAGSSSGPQGSHESPRRENLSRAPTGPGVLQYRGSHSDCTRIP

esr1

Estrogen receptor

583 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

64.03 kDa

MYPEESRGSGGVATVDFLEGLMTMTAPTPAPTPLYSHSTTGCYSAPLDAHGPLSDGSLQSLGSGPTSPLVFVPSSPRLSPFMHPPSHHYLETTSTPVYRSSHQPVPREDQCGTRDEAYSVGELGAGAGGFEITKNTRFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGMRKDRGRVLRREKHGPAQRQTSQNLPTHKASPQDGRKRAMSSSSTSGPGGRSSLNNMPPDQVLLLLQGAEPPILCSRQKMSRPYTEVTIMTLLTSMADKELVHMITWAKKLPGFLQLSLHDQVLLLESSWLEVLMIGLIWRSIQCPGKLIFEEDLILDRNEGTCVEGMAEIFDMLLATVRFRVLKLKPEEFVCLKAIILLNSGAFSFCTGTMEPLHDSVAVQHMLDTITDALIFHISHFGCSAQQQSRRQAQLLLLLSHIRHMSNKGMEHLYSMKCKNKVPLYDLLLEMLDAHRIHRPVKPSQSWSQGDRDSPTASSTSSRGGGGGDDEGASSAGSSSGPQGSHESPRRENLSRAPKGPGVLQYRGSHSDCTRIP

esr1

Estrogen receptor

581 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

63.461 kDa

MYPEDSRGSGGVATVDFLEGTYDYAAPTPAPTPLYSHSTPGYYSAPLDAHGPPSDGSLQSLGSGPNSPLVFVPSSPRLSPFMHPPTHHYLETTSTPVYRSSVPSSQQSVSREDQCGTSDDSYSVGESGAGALAAGFEIAKEMRFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDRNRRKSCQACRLRKCYEVGMMKGGMRKDRGRVLRRDKQRTGTSDRDKASKGLEHRTAPPQDRRKHISSSAGGGGGKSSMISMPPDQVLLLLQGAEPPMLCSRQKLNRPYTEVTMMTLLTSMADKELVHMIAWAKKLPGFLQLSLHDQVQLLESSWLEVLMIGLIWRSIHCPGKLIFAQDLILDRSEGDCVEGMAEIFDMLLATASRFRMLKLKPEEFVCLKAIILLNSGAFSFCTGTMEPLHDGAAVQNMLDTITDALIHHINQSGCSAQQQSRRQAQLLLLLSHIRHMSNKGMEHLYSMKCKNKVPLYDLLLEMLDAHRIHRADRPAETWSQADREPPFTSRNSSGGGGGGGGGSSSAGSTSGPRVSHESPTSPGVLQYGGSRSECTHIL

esr1

Estrogen receptor

581 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

63.627 kDa

MYPEDSRVSGGVATVDFLEGTYDYAAPTPAPTPLYSHSTPGYYSAPLDAHGPPSDGSLQSLGSGPNSPLVFVPSSPHLSPFMHPPTHHYLETTSTPIYRSSVPSSQHSVSREDQCGTSDDSYSVGESGAGAGAAGFEMAKEMRFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDRNRRKSCQACRLRKCYEVGMMKGGVRKDRGRVLRRDKRRTGTSDRDKASKGLEHRTAPPQDRRKHISSSAGGGGGKSSVISMPPDQVLLLLRGAEPPMLCSRQKVNRPYTEVTVMTLLTSMADKELVHMIAWAKKLPGFLQLSLHDQVQLLESSWLEVLMIGLIWRSIHCPGKLIFAQDLILDRSEGDCVEGMAEIFDMLLATASRFRMLKLKPEEFVCLKAIILLNSGAFSFCTGTMEPLHDSAAVQNMLDTITDALIHHINQSGCSAQQQSRRQAQLLLLLSHIRHMSNKGMEHLYSMKCKNKVPLYDLLLEMLDAHRVHRPDRPAETWSQADREPLFTSRNSSSSSGGGGGGSSSAGSTSGPQVNLESPTGPGVLQLRVHPHPMKPTE

esr1

Estrogen receptor

569 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

62.846 kDa

MYPKEEHSAGGISSSVNYLDGAYEYPNPTQTFGTSSPAEPASVGYYPAPPDPHEEHLQTLGGGSSSPLMFAPSSPQLSPYLSHHGGHHTTPHQVSYYLDSSSSTVYRSSVVSSQQAAVGLCEELCSATDRQELYTGSRAAGGFDSGKETRFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYVCPATNQCTIDRNRRKSCQACRLRKCYEVGMMKGGIRKDRGGRSVRRERRRSSNEDRDKSSSDQCSRAGVRTTGPQDKRKKRSGGVVSTLCMSPDQVLLLLLGAEPPAVCSRQKHSRPYTEITMMSLLTNMADKELVHMIAWAKKVPGFQDLSLHDQVQLLESSWLEVLMIGLIWRSIHSPGKLIFAQDLILDRSEGECVEGMAEIFDMLLATVARFRSLKLKLEEFVCLKAIILINSGAFSFCSSPVEPLMDNFMVQCMLDNITDALIYCISKSGASLQLQSRRQAQLLLLLSHIRHMSNKGMEHLYRMKCKNRVPLYDLLLEMLDAQRFQSSGKVQRVWSQSEKNPPSTPTTSSSSSNNSPRGGAAAIQSNGACHSHSPDP

esr1

Estrogen receptor

535 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

58.9 kDa

single

SRMLTDPPRIGSMQSLGSSPTGPLVFVSSSPQLSPFLHPPGHHGLPSQSYYLETSSTPLYRSSVVTNQLSASEEKLCITSNRQQSYAAAGSGVRVFEMANETRYCAVCSDFASGYHYGFWSCEGCKAFFKRSIQGHNDYMCPATNQCTMDRNRRKSCQACRLRKCYEVGMVKGGLRKDRGGRVLRKDKRYCGPAGDREKPYGDLEHRTAPPQDGGRNSSSSSLSGGGGWCGPRITMPPEQVLFLLQGAEPPALCSRQKVARPYTEVTMMTLLTSMADKELVHMIAWAKKVPGFQELSLHDQVQLLESSWLEVLMIGLIWRSIHCPGKLIFAQDLILDRSEGDCVEGMAEIFDMLLATVSRFRMLKLKPEEFVCLKAIILLNSGAFSFCSNSVESLHNSSAVESMLDNITDALIHHISHSGASVQQQPRRQVQLLLLLSHIRHMSNKGMEHLYSIKCKNKVPLYDLLLEMLDGHRLQSPGKVAQAGEQTEGPSTTTTTSTGSSIGPMRGSQDTHIRSPGSGVLQYGSPSSDQMPIP

esr1

Estrogen receptor

525 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

57.638 kDa

single

PTSPLVFVPSSPRLSPFMHPPSHHYLETTSTPVYRSSVSSSQQQLSREDQCGTSDDSYSVGESGAGAGAGAGGFEMAKEMRFCAVCSDYASGYDYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDRNRRKSCQACRLRKCYQVGMMKGGVRKDRGRVLRRDKRRTGTSDKASKDLEHRTAPPQDRRKHSSSSSSAGGGGKSSIIGMSPDQVLLLLQGAEPPVLCSRQKLSRPYTEVTMMTLLTSMADKELVHMIAWAKKLPGFLQLSLHDQVQLLESSWLEVLMIGLIWRSIHCPGKLIFAQDLILDRSEGDCVEGMAEIFDMLLATTSRFRMLKLKTEEFVCLKAIILLNSGAFSFCTGTMEPLHDGAAVQNMLDTITDALIHHISQSGCSAQQQSRRQAHLLLLLSHIRHMSNKGMEHLYSMKCKNKVPLYDLLLEMLDAHRIHRPDRPAESWSQADREPPYTTSNNNNSSSSSGGGDGGPSSAGSGSGPRVNHESLSRAPTGPGVLQYGGPRSDCTHIL

ESR1

Estrogen receptor

349 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

39.56 kDa

single

YEVGMMKGGIRKDRRGGRMLKHKRQREENDSRNAGALTEARSTALWPSPLMIKHSKKNSPALSLTADQMVSALLEAEPPVVYSEYDPSRPFNEASVMTLLTNLADRELVHMINWAKRVPGFVDLALHDQVHLLECAWLEILMVGLVWRSMEHPGKLLFAPNLLLDRSHGKVVEGFVEIFDMLLAASSRFRMMNVRGEEFVCLKSIILLNPGIYTYLSSTLKSVEERDHIHRVLDKITDTLMHLMAKSGLSLQQQHRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPAAKGSPPSEDDPLNQLAVPSPSMHSLLPCYVNKQEEGNEQEAI

ESR1

Ethylene-responsive transcription factor ESR1

328 amino acids

Regulates gene expression patterns in meristems and thus modulates organ development. Required for correct embryo patterning and cotyledon organogenesis. Modulates auxin signaling pathway in early embryos. Involved in the cytokinin signaling pathway that promotes shoot regeneration. Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity).

Belongs to the AP2/ERF transcription factor family. ERF subfamily.

36.319 kDa

MEKALRNFTESTHSPDPNPLTKFFTEPTASPVSRNRKLSSKDTTVTIAGAGSSTTRYRGVRRRPWGRYAAEIRDPMSKERRWLGTFDTAEQAACAYDSAARAFRGAKARTNFTYPTAVIMPEPRFSFSNKKSSPSARCPLPSLPLDSSTQNFYGAPAAQRIYNTQSIFLRDASCSSRKTTPYNNSFNGSSSSYSASKTACVSYSENENNESFFPEESSDTGLLQEVVQEFLKKNRGVPPSPPTPPPVTSHHDNSGYFSNLTIYSENMVQETKETLSSKLDRYGNFQANDDGVRAVADGGLSLGSNEWGYQEMLMYGTQLGCTCRRSWG

ESR1

Estrogen receptor

307 amino acids

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

35.202 kDa

single

GHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRILKHKRQREEHDNRNAGAIVERRSPNLWPSPLMITHNKKNSPALSLTADQIVSALLEAEPPVVYSEYDPSRPFSEASMMTLLTNLADRELVHMINWAKRVPGFVDLSLHDQVHLLECAWLEILMIGLVWRSVEHPGKLLFAPNLLLDRNQGKCVEGFVEIFDMLLATSSRFRMMNVQGEEFVCLKSIILLNSGIYTFLSSTLKSLEEKDHIHRVLDKIIDTLLHLMAKSGLSLQQQHRRLAQLLLILSHFRHMSNKGM

ESR1

CLAVATA3/ESR (CLE)-related protein ESR1

131 amino acids

Extracellular signal peptide that regulates cell fate.

Belongs to the CLV3/ESR signal peptide family.

14.432 kDa

MASRMGMVAIVSLFVCALAASTSVNANVWQTDDIPVVNSNMVRHSNMERQQQQGGFIGHRPRLASFNRASNQDGDRKRTVPSGPDHMHHSIPSHTPQHPPVYVQALYEDDRSRTSSGPSKSIGPPPLSDRY

ESR1

Estrogen receptor

121 amino acids

Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3 (By similarity).

Belongs to the nuclear hormone receptor family. NR3 subfamily.

13.836 kDa

single

LFAPNLLLDRNQGKCVEGMVESFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGME

ESR1

Estrogen receptor

111 amino acids

Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3 (By similarity).

Belongs to the nuclear hormone receptor family. NR3 subfamily.

12.527 kDa

single

PSGYAVREAGPPAYYRPNSDNRRQGGRERLASTSDKGSMAVESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCY