ERG9

Squalene synthase

572 amino acids

Catalyzes the condensation of 2 two farnesyl pyrophosphate moieties to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway. Required for the biosynthesis of ergosterol (By similarity).

Belongs to the phytoene/squalene synthase family.

65.523 kDa

MGLLSYILLGFTHPSELRAMIGYKVWRDPLNDIKANPQASGWDRQRMRDCWGFLDLTSRSFAAVIKELKGELSRVICLFYLVLRALDTVEDDMTIPAQRKIPLLVNFYKYLEQPGWNFTESGPNEKDRQLLVEFDKVIAEYQLLDVGYKTVISDITAKMGAGMASYIELSAKGPLKVAMWKHFDLYCHFVAGLVGEGLSRLFSESKLERPWLGHQLELSNHMGLFLQKTNIIRDYAEDCEEGRYFWPQQCWGDDFAKFESQPDVAKGIIEIKPGHFRPADNELGQRSMYVLSSMLLDAMSHATHALDYLALLKEQSVFNFCAIPQVMAIATLELMFNNPDVFKKNVKIRKGVAVGLILRAVNPRDVAYTFLHYSRKMHARLSPADPNFTRWSVELARIEQWCETYYPSFIAAASEGKPTDIRANALRSWSESRRTQALILKQAKLNGSDASTLDAKSVLEAAQNSALDPRDLMTEDERAAQDKRDRDQMVKFFLIILVGMVTFMGIVALITWEIVWWWTMDTPDPLSVYVKHAYYLVKTQGWSTVKEVLRTTRLSFEHVWKHGLTSPPKLEL

erg9

Squalene synthase

460 amino acids

Catalyzes the condensation of 2 two farnesyl pyrophosphate moieties to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway. Required for the biosynthesis of ergosterol.

Belongs to the phytoene/squalene synthase family.

53.321 kDa

MSLANRIEEIRCLCQYKLWNDLPSYGEDENVPQNIRRCYQLLDMTSRSFAVVIKELPNGIREAVMIFYLVLRGLDTVEDDMTLPLDKKLPILRDFYKTIEVEGWTFNESGPNEKDRQLLVEFDVVIKEYLNLSEGYRNVISNITKEMGDGMAYYASLAEKNDGFSVETIEDFNKYCHYVAGLVGIGLSRLFAQSKLEDPDLAHSQAISNSLGLFLQKVNIIRDYREDFDDNRHFWPREIWSKYTSSFGDLCLPDNSEKALECLSDMTANALTHATDALVYLSQLKTQEIFNFCAIPQVMAIATLAAVFRNPDVFQTNVKIRKGQAVQIILHSVNLKNVCDLFLRYTRDIHYKNTPKDPNFLKISIECGKIEQVSESLFPRRFREMYEKAYVSKLSEQKKGNGTQKAILNDEQKELYRKDLQKLGISILFVFFIILVCLAVIFYVFNIRIHWSDFKELNLF

ERG9

Squalene synthase

448 amino acids

Catalyzes the condensation of 2 two farnesyl pyrophosphate moieties to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway. Required for the biosynthesis of ergosterol (By similarity).

Belongs to the phytoene/squalene synthase family.

51.171 kDa

MGKFLQLLSHPTELKAVIQLFGFRQPLHPGKRDVNDKELGRCYELLNLTSRSFAAVIEELHPELRDAVMIFYLVLRALDTIEDDMTIKSSIKIPLLREFDTKLNTKNWTFDGYGPNEKDRTVLVEFDKILNVYHRLKPQYQDIIKSITFKMGNGMADYILDEEFNVYGVATVEDYNLYCHYVAGLVGEGLTNLFVLANFGDKTLTENNFAKADSMGLFLQKTNIIRDYHEDLQDGRSFWPREIWSKYTENLQDFHKVKTPAKEFAGVSCINELVLNALGHVTDCLDYLSLVKDPSSFSFCAIPQVMAVATLAEVYNNPKVLHGVVKIRKGTTCRLILESRTLPGVVKIFKEYIQVINHKSSVRDPNYLKIGIKCGEIEQYCEMIYPNKQALPPSMKSLPENKFTKIVASRESIDLSVQRRIEPGNFNCNVVLFGIGALILSLIYFVLY

ERG9

Squalene synthase

444 amino acids

Catalyzes the condensation of 2 two farnesyl pyrophosphate moieties to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway. Required for the biosynthesis of ergosterol. May also have a regulatory role regulating the flux of isoprene intermediates through the sterol pathway. Squalene synthase is crucial for balancing the incorporation of farnesyl diphosphate (FPP) into sterol and nonsterol isoprene synthesis. ERG9 is also essential for cell growth in yeast.

Belongs to the phytoene/squalene synthase family.

51.72 kDa

MGKLLQLALHPVEMKAALKLKFCRTPLFSIYDQSTSPYLLHCFELLNLTSRSFAAVIRELHPELRNCVTLFYLILRALDTIEDDMSIEHDLKIDLLRHFHEKLLLTKWSFDGNAPDVKDRAVLTDFESILIEFHKLKPEYQEVIKEITEKMGNGMADYILDENYNLNGLQTVHDYDVYCHYVAGLVGDGLTRLIVIAKFANESLYSNEQLYESMGLFLQKTNIIRDYNEDLVDGRSFWPKEIWSQYAPQLKDFMKPENEQLGLDCINHLVLNALSHVIDVLTYLAGIHEQSTFQFCAIPQVMAIATLALVFNNREVLHGNVKIRKGTTCYLILKSRTLRGCVEIFDYYLRDIKSKLAVQDPNFLKLNIQISKIEQFMEEMYQDKLPPNVKPNETPIFLKVKERSRYDDELVPTQQEEEYKFNMVLSIILSVLLGFYYIYTLHRA

ERG9

Squalene synthase

443 amino acids

Catalyzes the condensation of 2 two farnesyl pyrophosphate moieties to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway. Required for the biosynthesis of ergosterol.

Belongs to the phytoene/squalene synthase family.

51.397 kDa

MGKVLDLALHPLELRAALKLKFIRQPLFSTNDTRATPQLERCYELLNLTSRSFAAVIMELHPELRNVIMVFYLILRALDTVEDDMTIDPQLKVKVLREFDSKLDTTDWSFDGNDLKEKDRVVLTEFPCILGEYHKLKPEYQKVIKRITGLMGNGMADYILDENFNLNGVQTVKDYDKYCHYVAGLVGDGLTELIVLAGFGSDDLYHGKNSFQLYESMGLFLQKTNIIRDYAEDLDDGRSFWPKEIWSEYATKLTDFRDPKNTQKGVDCINHLVLNALTHVIDVLTYLSSIHEQSSFQFCAIPQVMAIATLAKVFNNPEVLRKNVKIRKGTTCDLILNSRTLKGCVDIFQYYLRDMKQRLPVEDPNYLKFNIQVAKIEQFIEEMFQDNLPAGVEPRETMIYLKVQERLKWDTQVIPRVQEEDYKFNMALSVVFCVLLSFYFFTK

ERG9

Squalene synthase

443 amino acids

Catalyzes the condensation of 2 two farnesyl pyrophosphate moieties to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway. Required for the biosynthesis of ergosterol.

Belongs to the phytoene/squalene synthase family.

50.954 kDa

MGKLLQLALHPDELASIVQFKLFRKNENARNPATESAELIRCYELLNLTSRSFAAVIEELHPELRNVIMVFYLVLRALDTVEVDMSIENSVKLPVLRQFHEKLDTKDWTFDGNSPNEKDRCVLVEFDRILGQYHELKPQYQKVIKEITEKMGNGMADYIENENFNSNGLLTIEDYDLYCYYVAGLVGDGLTQLIVLAKFGNSELSVNKQLFKSMGLFLQKTNIIRDYEEDQVDGRAFWPKEIWGKYANELSDFMKPENQSQGLWCISELVCNALDHVIDVLQYLALVEEQTSFNFCAIPQVMAIATLELVFQNPQVLTQHVKIRKGTTVSLILESRTLEGCARIFRRYLRKIHHKSHPSDPNYLRLGITIGKIEQFLDGMYPHYVPKGITPQTTSIRTQVVKRLQLDEPMKRDIDEEILKTRILLLSLGVAVFGVVYGVVRII

ERG9

Squalene synthase

441 amino acids

Catalyzes the condensation of 2 two farnesyl pyrophosphate moieties to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway. Required for the biosynthesis of ergosterol (By similarity).

Belongs to the phytoene/squalene synthase family.

50.873 kDa

MGKVVQLFTHPLELKAALKLKFLREPLYPADDTQGSAELKRCYQLLQRTSRSFAAVIMELHPELRNAVMLFYLILRALDTVEDDMTISPKVKVPLLREFDQKLKLDTWSFDGNAKTEKDRDVLVEFSTILAEFHKLKPEYQQVIADITHKMGNGMADYILDEKFNLSGLETIQDYDRYCHYVAGLVGDGLTHLIMLAKFSSPGLYYDSPDLYESMGLFLQKTNIIRDYAEDLADGRSFWPKEIWSHYADDLASFSKPENATAGVYCINHLVLNALGHVQHVLTYLASLREQSSFQFCAIPQVMAIATLALVFGNERVLQTSVKIRKGTTCYLILKSRTFQGCVEIFEHYLRDIRKRLTVADPNYLKLNIEIAKLDKFIEEMYQDKLPVGAKPQETEIYKKVRERSAYDLEVLPREQEEEFKFNVLLSILFTVFGALYWYAK