elfA

Laminin-binding fimbrial subunit ElfA

182 amino acids

Part of the elfADCG fimbrial operon, which could be required for adherence to host epithelial cells. ElfA is an accessory colonization factor that contributes to adherence of bacteria to human intestinal epithelial cells and to animal intestinal tissue in vitro. Binds specifically to laminin, but not to fibronectin or collagen type IV.

Belongs to the fimbrial protein family.

19.04 kDa

MITMKKSVLTAFITVVCATSSVMAADDNAITDGSVTFNGKVIAPACTLVAATKDSVVTLPDVSATKLQTNGQVSGVQTDVPIELKDCDTTVTKNATFTFNGTADTTQITAFANQASSDAATNVALQMYMNDGTTAIKPDTETGNILLQDGDQTLTFKVDYIATGKATSGNVNAVTNFHINYY

elfA

Laminin-binding fimbrial subunit ElfA

182 amino acids

Part of the elfADCG fimbrial operon, which could be required for adherence to host epithelial cells. ElfA is an accessory colonization factor that contributes to adherence of bacteria to human intestinal epithelial cells and to animal intestinal tissue in vitro. Binds specifically to laminin, but not to fibronectin or collagen type IV.

Belongs to the fimbrial protein family.

19.04 kDa

MITMKKSVLTAFITVVCATSSVMAADDNAITDGSVTFNGKVIAPACTLVAATKDSVVTLPDVSATKLQTNGQVSGVQTDVPIELKDCDTTVTKNATFTFNGTADTTQITAFANQASSDAATNVALQMYMNDGTTAIKPDTETGNILLQDGDQTLTFKVDYIATGKATSGNVNAVTNFHINYY

elfA

Fimbrial subunit ElfA

179 amino acids

Part of the elfADCG-ycbUVF fimbrial operon, which promotes adhesion of bacteria to different abiotic surfaces. ElfA is the major fimbrial subunit produced by this operon.

Belongs to the fimbrial protein family.

18.68 kDa

MKKSVLTAFITVVCATSSVMAADDNAITDGSVTFNGKVIAPACTLVAATKDSVVTLPDVSATKLQTNGQVSGVQIDVPIELKDCDTTVTKNATFTFNGTADTTQITAFANQASSDAATNVALQMYMNDGTTAITPDTETGNILLQDGDQTLTFKVDYIATGKATSGNVNAVTNFHINYY

elfA

Fimbrial subunit ElfA

179 amino acids

Part of the elfADCG-ycbUVF fimbrial operon, which promotes adhesion of bacteria to different abiotic surfaces. ElfA is the major fimbrial subunit produced by this operon.

Belongs to the fimbrial protein family.

18.68 kDa

MKKSVLTAFITVVCATSSVMAADDNAITDGSVTFNGKVIAPACTLVAATKDSVVTLPDVSATKLQTNGQVSGVQIDVPIELKDCDTTVTKNATFTFNGTADTTQITAFANQASSDAATNVALQMYMNDGTTAITPDTETGNILLQDGDQTLTFKVDYIATGKATSGNVNAVTNFHINYY