efp1

Elongation factor P 1

191 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.073 kDa

MVQAINLKKGMIFSQDGKLIKVLKANHHKPGKGNTVMQMDLRDVKSGAVVHKTMRPTEKVDLVEVTKKSAQYLYNEGDNYTFMDTDTYDQYEVSADQLGDDIKFLMPNIVVDMDFTDDNKIIGIELPSTVEMTVKETQPGIKGATVAGGGKPATMETGLVVQVPDFINEGEKLVIGTENGDYKSRANSQPR

efp1

Elongation factor P 1

190 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity).

Belongs to the elongation factor P family.

21.065 kDa

MQAIELKKGMIFNQDGKLIEVLKSNHHKPGKGNTVMQMDLRDVMSGAVVHKTMRPSEKVDLVNVSLKKAQYLYDDDTDFIFMDTDTYEQYLIPKEHLASEAKFLMPNIEVDLKFTDEGKLIGINLPSTVKMTVKETQPEIKGATAAGGGKPATMDTGLVVTVPDFIKEGEELIIGTENGDYKGRADSITR

efp1

Elongation factor P 1

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity).

Belongs to the elongation factor P family.

21.179 kDa

MATTADFRNGMCLEIEGQYYFIVEFLHVKPGKGPAFVRTKLKNVATGRILDKTWNSGVKVEEVRIERRPYQYLYQDEMGYNFMHPETFEQITIPGASIDGVQFLKDGDMVEAMVHATSETVLTCELPPHVKLRVTYTEPGLKGDTATNTLKPATVETGAEVRVPLFIQEGELIEVDTRDGSYIGRVKE

efp1

Elongation factor P 1

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.979 kDa

MAKINGNEIRPGYVIEHDGGLWVAVRTNTVKPGKGGAYNQVELKNLINGTKLNERFRSAETVEQIRLDLKDFSFLYEQDDALVFMDTQSYEQLELNKDFVGDRAAFLQDGMMVTVQLYEERPIGISLPDQVTLTITEADPVVKGQTAAASYKPAVLKNGIRVLVPPFIGAGERIIVDTNEITYVRRAD

efp1

Elongation factor P 1

187 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.059 kDa

MLTTSDFKRGLVIKLDNSPCLILDVHFQSPSARGASTMVKTRYRNLLTGQVLDKTFRSGDKVEEADFERHKGQYLYADGDRGVFMDMETYEQFEMDAESFQVIQPYLLDGTEVVLGLFQERLVSVDPPQVVELTITDTPPVIKNATATAQTKEATLETGLTLQVPPYLEVGEKIKVDTRDCRFISRA

efp1

Elongation factor P 1

185 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity).

Belongs to the elongation factor P family.

20.759 kDa

MVLSSQLSVGMFISTKDGLYKVVAVSKVTGNKGESFIKASLKAADSDVIVERNFKIGQEIKEAQFESRNLEYLYIEDENFLFLDLGNYEKIYISKEIMKDNFLFLKAGVTVSAMVYDDVVFSIELPHFLELMVSKTDFPGDSLLITGGTKKALLETGVEITVPPFVEIGDIIKIDTRTCEYIQRV

efp1

Elongation factor P 1

185 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity).

Belongs to the elongation factor P family.

20.468 kDa

MVLSSQLSVGMFISTKDGLYKVVSVSKVSGSKGDTFIKVALQAAGSDVVVERNFKAGQEVKEAQFEPRNLEYLYLEEDNYLFLDLGNYEKIYIPKEIMKENAMFLKAGVTISALVHEGIVFSMELPHFLELMVSKTDFPGDSLSLSGGAKKALLETGVEVLVPPFVEIGDVIKVDTRTCEYIQRV

efp1

Elongation factor P 1

185 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity).

Belongs to the elongation factor P family.

20.673 kDa

MVLSSQLSVGMFISTKDGLYKVTSVSKVAGPKGESFIKVALQAADSDVVIERNFKATQEVKEAQFETRTLEYLYLEDESYLFLDLGNYEKLFIPQEIMKDNFLFLKAGVTVSAMVYDNVVFSVELPHFLELMVSKTDFPGDSLSLSGGVKKALLETGIEVMVPPFVEIGDVIKIDTRTCEYIQRV

efp1

Elongation factor P 1

185 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity).

Belongs to the elongation factor P family.

20.517 kDa

MVLSSQLSVGMFISTKDGLYKVVSVSKVSGNKGDTFIKVSLQAAGSDVTVERNFKAGQEVKEAQFEPRNLEYLYLEEDKYLFLDLGNYDKIYIPKEIMKDNAMFLKAGVTVFALVHEGTVFSMELPHFLELMVAKTDFPGDSLSLSGGAKKALLETGVEVLVPPFVEIGDVIKVDTRTCEYIQRV

efp1

Elongation factor P 1

184 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity).

Belongs to the elongation factor P family.

20.672 kDa

MATSNQLTPGMTLSINNKLYRVESSVKVTVPKGTPFIKAKLKDLSNNEMVEKSFKLNQPIKDVSLIERRLEFLYPEGDEYLFLDVVNLDQVLVPAEIVSGKVNYLKEGVEIKAFFYGETIFAVELPQFLELMVAKTHSDDENDLANGAKIAILETGAKIEVPPFIETGDIIKVDTKTDEYIQRV