ecpA

Extracellular cysteine protease

395 amino acids

Cysteine protease able to cleave elastin, insulin, myoglobin, fibronectin, fibrinogen, HMW-kininogen, alpha-1-protease inhibitor and alpha-1-antitrypsin. Along with other extracellular proteases may contribute to the colonization and infection of human tissues (By similarity).

Belongs to the peptidase C47 family.

44.701 kDa

MKKKLSYMITIMLAFTLSLALGLFFNSAHADSLPQKNGANQKTTKVTVSNKDVPDAVRKLAEEQYLSRVALLDKASNHKATSYTLGEPFKIYKFNKESDGNYYYPVLNKKGDVVYVVTISPNPSNSKASKQQNNYSINVSPFLSKILNQYKNQKITILTNTKGYFALTEDGKVTLVLKTPRNNEKTYENATESTKPKDLNDFKQTASVTKPTLEYQSTRNEMYAEYVNQLKNFRIRETQGYNSWCAGYTMSALLNATYNTNRYNAESVMRYLHPNLRGHDFQFTGLTSNEMLRFGRSQGRNTQYLNRMTSYNEVDQLTTNNQGIAVLGKRVESSDGIHAGHAMAVAGNAKVNNGQKVILIWNPWDNGLMTQDAHSNIIPVSNGDHYEWYASIYGY

ecpA

Extracellular cysteine protease

395 amino acids

Cysteine protease able to cleave elastin, insulin, myoglobin, fibronectin, fibrinogen, HMW-kininogen, alpha-1-protease inhibitor and alpha-1-antitrypsin. Along with other extracellular proteases may contribute to the colonization and infection of human tissues (By similarity).

Belongs to the peptidase C47 family.

44.701 kDa

MKKKLSYMITIMLAFTLSLALGLFFNSAHADSLPQKNGANQKTTKVTVSNKDVPDAVRKLAEEQYLSRVALLDKASNHKATSYTLGEPFKIYKFNKESDGNYYYPVLNKKGDVVYVVTISPNPSNSKASKQQNNYSINVSPFLSKILNQYKNQKITILTNTKGYFALTEDGKVTLVLKTPRNNEKTYENATESTKPKDLNDFKQTASVTKPTLEYQSTRNEMYAEYVNQLKNFRIRETQGYNSWCAGYTMSALLNATYNTNRYNAESVMRYLHPNLRGHDFQFTGLTSNEMLRFGRSQGRNTQYLNRMTSYNEVDQLTTNNQGIAVLGKRVESSDGIHAGHAMAVAGNAKVNNGQKVILIWNPWDNGLMTQDAHSNIIPVSNGDHYEWYASIYGY

ecpA

Common pilus major fimbrillin subunit EcpA

211 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

21.915 kDa

MTHWDITSSIQLGKKCNEKKVLAIALVTVFTGMGVAQAADVTAQAVATWSATAKKDTTSNLVVTSLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFTIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

205 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

21.156 kDa

MSSIQLGKKSNEKKVLAIALVTVFTGTGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGATVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

20.081 kDa

MKKKVLAIALVTVFTGTGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria.

Belongs to the EcpA/MatB fimbrillin family.

20.111 kDa

MKKKVLAIALVTVFTGTGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGTAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

20.125 kDa

MKKKVLAIALVTVFTGMGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFTIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

20.111 kDa

MKKKVLAIALVTVFTGMGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

20.081 kDa

MKKKVLAIALVTVFTGTGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

20.125 kDa

MKKKVLAIALVTVFTGMGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFTIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

20.109 kDa

MKKKVLAIALVTVFTGTGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNVSNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

19.971 kDa

MKKKVLAIALVTAFTGMGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDATATAFKLTSRLITNTLTQLDTSGSTLSVGVDYNGAAVEKTADTVMIDTANGVLGGNLSALANGYNASGRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

20.076 kDa

MKKKVLAIALVTAFTGMGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDTTATAFKLTSRLITNTLTQLDTSGSTLSVGVDYNGAAVEKTGDTVMIDTANNIMGGNLSALANGYNASGRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

20.125 kDa

MKKKVLAIALVTVFTGMGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFTIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

20.081 kDa

MKKKVLAIALVTVFTGTGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria.

Belongs to the EcpA/MatB fimbrillin family.

20.111 kDa

MKKKVLAIALVTVFTGMGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

20.111 kDa

MKKKVLAIALVTVFTGMGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

20.081 kDa

MKKKVLAIALVTVFTGTGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

20.111 kDa

MKKKVLAIALVTVFTGMGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria (By similarity).

Belongs to the EcpA/MatB fimbrillin family.

20.081 kDa

MKKKVLAIALVTVFTGTGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Common pilus major fimbrillin subunit EcpA

195 amino acids

Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria.

Belongs to the EcpA/MatB fimbrillin family.

20.081 kDa

MKKKVLAIALVTVFTGTGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

ecpA

Extracellular cysteine protease

174 amino acids

Cysteine protease able to cleave elastin, insulin, myoglobin, fibronectin, fibrinogen, HMW-kininogen, alpha-1-protease inhibitor and alpha-1-antitrypsin. Along with other extracellular proteases may contribute to the colonization and infection of human tissues.

Belongs to the peptidase C47 family.

19.832 kDa

MYAEYVNQLKNFRIRETQGYNSWCAGYTMSALLNATYNTNRYNAESVMRYLHPNLRGHDFQFTGLTSNEMLRFGRSQGRNTQYLNRMTSYNEVDQLTTNNQGIAVLGKRVESSDGIHAGHAMAVAGNAKVNNGQKVILIWNPWDNGLMTQDAHSNIIPVSNGDHYEWYASIYGY

ecpA

Fimbrial protein EcpA

159 amino acids

Belongs to the N-Me-Phe pilin family.

16.178 kDa

MKQVQKGFTLIELMIVIAIIGILAAIALPLYQDYISKSQVTRAYGEMAGTKTAIEAALFEGRTPVLAATAAAGAAATPPNEWVGMLDNPTSNLLSAATLTPGANAGDVTFVGTLGENANSSIHGATITLTCTASGEWTCAVAAGTATGWKTKFVPSGCN