eIF3g1

Eukaryotic translation initiation factor 3 subunit G-1

270 amino acids

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.

Belongs to the eIF-3 subunit G family.

30.071 kDa

MPGIETIKSSWADEVELDYGGLPPTTETVENGHKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGESKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNMMEKKATAAAAAAVDAPKSGKYVPPFLKDSVGKVGMGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQNN

eIF3g1

Eukaryotic translation initiation factor 3 subunit G-1

269 amino acids

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.

Belongs to the eIF-3 subunit G family.

29.951 kDa

MPGVETIKSSWADEVELDYGGLPPTTETVENGHKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGESKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNLMEKKASAAAAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQNN

eIF3g1

Eukaryotic translation initiation factor 3 subunit G-1

269 amino acids

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.

Belongs to the eIF-3 subunit G family.

29.908 kDa

MPGIETIKSSWADEVELDYGGLPPTTETIENGHKYVTEYKYNKDDKKTKVVRTYKITKQVVPKTVAKRRTWAKFGESKNDKPGPNSQTTMVSEDIIMQFINSKEDEKANDPLLDPSKNIAKCRICNGEHWSVNCPYKGTAMDTNLMEKKAAAAASAAVDAPKSGKYVPPFLKDSQKGGMGIRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQNT

eIF3g1

Eukaryotic translation initiation factor 3 subunit G-1

269 amino acids

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.

Belongs to the eIF-3 subunit G family.

29.946 kDa

MPGVETIKSSWADEVELDYGGLPPTTETVENGQKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGDSKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNMMEKKASAAAAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQNN

eIF3g1

Eukaryotic translation initiation factor 3 subunit G-1

269 amino acids

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.

Belongs to the eIF-3 subunit G family.

29.955 kDa

MPGVETIKSSWADEVELDYGGLPPTTETIENGHKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGDSKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNLMEKKAAAAASAAVDAPKSGKYVPPFLKDSQKGGMGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQNN

eIF3g1

Eukaryotic translation initiation factor 3 subunit G-1

269 amino acids

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.

Belongs to the eIF-3 subunit G family.

29.932 kDa

MPGVETIKSSWADEVELDYGGLPPTTENVENGHKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGESKSDKPGPNSHTTMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNLMEKKAAAAASAAVDAPKSGKYVPPFLKDSQKGGLGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQNN

eIF3g1

Eukaryotic translation initiation factor 3 subunit G-1

269 amino acids

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.

Belongs to the eIF-3 subunit G family.

29.932 kDa

MPGVETIKSSWADEVELDYGGLPPTTENVENGHKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGESKSDKPGPNSHTTMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNLMEKKAAAAASAAVDAPKSGKYVPPFLKDSQKGGLGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQNN

eIF3g1

Eukaryotic translation initiation factor 3 subunit G-1

269 amino acids

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.

Belongs to the eIF-3 subunit G family.

29.994 kDa

MPGVETIKSSWADEVELDYGGLPPTTETVENGQKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGESKNDKPGPNSQTTMVSEEIFMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNMMEKKASAAAAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQNN

eIF3g1

Eukaryotic translation initiation factor 3 subunit G-1

269 amino acids

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.

Belongs to the eIF-3 subunit G family.

29.994 kDa

MPGVETIKSSWADEVELDYGGLPPTTETVENGQKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGESKNDKPGPNSQTTMVSEEIFMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNMMEKKASAAAAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQNN

eIF3g1

Eukaryotic translation initiation factor 3 subunit G-1

269 amino acids

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.

Belongs to the eIF-3 subunit G family.

29.941 kDa

MPGVETIKSSWADEVELDYGGLPPTTETIENGHKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGDSKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPSKNIAKCRICNGEHWSVNCPYKGTAMDTNLMEKKAAAAASAAVDAPKSGKYVPPFLKDSQKGGMGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQNN

eIF3g1

Eukaryotic translation initiation factor 3 subunit G-1

269 amino acids

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.

Belongs to the eIF-3 subunit G family.

29.941 kDa

MPGVETIKSSWADEVELDYGGLPPTTETVENGHKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGESKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPSKNIAKCRICNGEHWSVNCPYKGTAMDTNLMEKKAAAAASAAVDAPKSGKYVPPFLKDSQKGGMGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQNN

eIF3g1

Eukaryotic translation initiation factor 3 subunit G-1

269 amino acids

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.

Belongs to the eIF-3 subunit G family.

29.951 kDa

MPGVETIKSSWADEVELDYGGLPPTTETVENGHKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGESKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNLMEKKASAAAAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQNN