eIF1A1

Translation initiation factor 1A 1

111 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

12.918 kDa

MTLADLKKPTSRATPSTEETFTRVRTPRRENNEILATVESLLGANRLRLRCMDGVVRMGRIPGSMKKKTWIREGDVVIVVPWEFQNEKADVIWKYTRPQVDWLERKGYLKG

eIF1A1

Translation initiation factor 1A 1

111 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

12.798 kDa

MTLADLKKPTSRASPSTEETVTRVRTPRRENNEILATVESLLGANRLRLRCMDGVVRMGRIPGSMKKKAWIREGDVVIAVPWEFQNEKADVIWKYTRPQVDWLERKGYLKG

eif1a1

Translation initiation factor 1A 1

96 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

11.348 kDa

MSDDENRGSHDLRMPDDDEVFAVVTNMLGANRVTVRCADGNERTARIPGRMQKRIWIREDDVVLVEPWDWQDEKGDITWRYEKSEADQLREEGRIR

eif1a1

Translation initiation factor 1A 1

96 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

11.102 kDa

MPATQEVTRVRTPRRENHEVLATVSSLLGSKRVTLQCMDGVVRMGRIPGSKNKKMWIHEGDVVIVAPWDIQDSKADVIWKYTRPQVEWLERKGYLK

eIF1A1

Translation initiation factor 1A 1

95 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

11.148 kDa

MSDDGGGRKNLRMPEDDEVFAEVTDMLGANRVQVRCADGEERTARIPGRMQKRIWIREDDIVLVEPWDWQDDKADVTWRYEKSDADQLREEGHIE