dxo

Decapping and exoribonuclease protein

401 amino acids

Ribonuclease that specifically degrades pre-mRNAs with a defective 5' end cap and is part of a pre-mRNA capping quality control. Has decapping, pyrophosphohydrolase and 5'-3' exonuclease activities. Has decapping activity toward incomplete 5' end cap mRNAs such as unmethylated 5' end-capped RNA to release GpppN and 5' end monophosphate RNA. The 5' end monophosphate RNA is then degraded by the 5'-3' exoribonuclease activity, enabling this enzyme to decap and degrade incompletely capped mRNAs. Also possesses RNA 5'-pyrophosphohydrolase activity by hydrolyzing the 5' end triphosphate to release pyrophosphates (By similarity).

Belongs to the DXO/Dom3Z family.

46.194 kDa

MEGNKSMQREKIDRPMKRGPEQNSLSPPLAKCPFMSCSSLKTLHSLYQGSFPFYRLPSEVGHFSLDENRQYHQDNRKLRYYSPPVGIREKGSPGWNVMDGYESHYVRRNEDEKEGLLHILTWLEKNRGVLGAHVEGGSKRPIDRDFVTWRGHLTKILCTPYETQEGWLLAVTLFKGTFYISEQETEAAQKKRKERSLEQERLMYSGYKFESYICADSPDRQPSQSAVVNTNEGFCSVLLARLTSHSLLISGEVDCTDPSAKKSIPPTCYIELKSSAQIRNPHQQRSFNRYKLLKWWCQSFLLGIPIIVAGFRSPEGRIVSLETFKTSDIPHLVRGERNSWDPAVCMNFCNKFLSHIKSVVTRDDPRLVYLFAWEPGCDVTFTVHTDPEYTILPSWYVNSVN

DXO

Decapping and exoribonuclease protein

397 amino acids

Ribonuclease that specifically degrades pre-mRNAs with a defective 5' end cap and is part of a pre-mRNA capping quality control. Has decapping, pyrophosphohydrolase and 5'-3' exonuclease activities. Has decapping activity toward incomplete 5' end cap mRNAs such as unmethylated 5' end-capped RNA to release GpppN and 5' end monophosphate RNA. The 5' end monophosphate RNA is then degraded by the 5'-3' exoribonuclease activity, enabling this enzyme to decap and degrade incompletely capped mRNAs. Also possesses RNA 5'-pyrophosphohydrolase activity by hydrolyzing the 5' end triphosphate to release pyrophosphates (By similarity).

Belongs to the DXO/Dom3Z family.

45.168 kDa

MESRGTKREAGKIEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGQSPNFDLRDGYPDRYQPRDEEVQERLDHLLRWLLEHRGQLEGGPGWLAGAIVTWRGHLTKLLTTPYERQEGWQLAASRFRGTLYLSEVETPAARVQRLTRPPLLRELMYMGYKFEQYMCADKPGVSPDPSGEVNTNVAFCSVLRSRLGNHPLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMHSPGQWKSFYRHKLLKWWAQSFLPGVPNVVAGFRNPEGFVCSLKTFPTMEMFEYVRNDRDGWNPSVCMNFCAAFLSFAQNTAVQDDPRLVYLFSWEPGGPVTVSEHRDAPHAFLPPWYVEAVTQDLPSPPKTPSPKD

Dxo

Decapping and exoribonuclease protein

397 amino acids

Ribonuclease that specifically degrades pre-mRNAs with a defective 5' end cap and is part of a pre-mRNA capping quality control. Has decapping, pyrophosphohydrolase and 5'-3' exonuclease activities. Has decapping activity toward incomplete 5' end cap mRNAs such as unmethylated 5' end-capped RNA to release GpppN and 5' end monophosphate RNA. The 5' end monophosphate RNA is then degraded by the 5'-3' exoribonuclease activity, enabling this enzyme to decap and degrade incompletely capped mRNAs. Also possesses RNA 5'-pyrophosphohydrolase activity by hydrolyzing the 5' end triphosphate to release pyrophosphates.

Belongs to the DXO/Dom3Z family.

45.28 kDa

MEPRGTKRKAEKTEVEKPLNKLPRAVPSLRTQPSLYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPINGPGPDFDLRDGYPDRYQPRDEEVQERLDHLLRWVLEHRNQLEGGPGWLAGATVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGGSPDPSGEVNTNVAYCSVLRSRLGNHPLLFSGEVDCLNPQAPCTQPPSCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPHVVAGFRNPEGFVCSLKTFPTMEMFENVRNDREGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHRDAPYAFLPSWYVETMTQDLPPLSKTPSPKD

Dxo

Decapping and exoribonuclease protein

397 amino acids

Ribonuclease that specifically degrades pre-mRNAs with a defective 5' end cap and is part of a pre-mRNA capping quality control. Has decapping, pyrophosphohydrolase and 5'-3' exonuclease activities. Has decapping activity toward incomplete 5' end cap mRNAs such as unmethylated 5' end-capped RNA to release GpppN and 5' end monophosphate RNA. The 5' end monophosphate RNA is then degraded by the 5'-3' exoribonuclease activity, enabling this enzyme to decap and degrade incompletely capped mRNAs. Also possesses RNA 5'-pyrophosphohydrolase activity by hydrolyzing the 5' end triphosphate to release pyrophosphates (By similarity).

Belongs to the DXO/Dom3Z family.

45.299 kDa

MEPRGTKRKAEKTEVAKTWNKLPRSLPSLRTQPSLYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPINGPGPDFDLRDGYPDRYQPRDEEVRERLDHLLRWVLEHRNQLEGGPGWLAGATVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGGSPDPSGEVNTNVAFCSVLRSRLGNHPLLFSGEVDCLNPQAPCTQPPSCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPYVVAGFRNPEGFVCSLKTFPTMEMFENVRNDQEGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHRDAPYAFLPSWYVEAMTQDLPSLSKTPSPKD

DXO

Decapping and exoribonuclease protein

396 amino acids

Ribonuclease that specifically degrades pre-mRNAs with a defective 5' end cap and is part of a pre-mRNA capping quality control. Has decapping, pyrophosphohydrolase and 5'-3' exonuclease activities. Has decapping activity toward incomplete 5' end cap mRNAs such as unmethylated 5' end-capped RNA to release GpppN and 5' end monophosphate RNA. The 5' end monophosphate RNA is then degraded by the 5'-3' exoribonuclease activity, enabling this enzyme to decap and degrade incompletely capped mRNAs. Also possesses RNA 5'-pyrophosphohydrolase activity by hydrolyzing the 5' end triphosphate to release pyrophosphates (By similarity).

Belongs to the DXO/Dom3Z family.

44.929 kDa

MDPRGTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDLRDGYPDRYQPRDEEVQERLDHLLCWLLEHRGRLEGGPGWLAEAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPNARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLGSHPLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPNVVAGFRNPDGFVSSLKTFPTMKMFEYVRNDRDGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHQDAPYAFLPIWYVEAMTQDLPSPPKTPSPK