djlA

Co-chaperone protein DjlA

296 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

34.13 kDa

MNLRDFFVITTWWGKILGAFFGYLTAGPVGALFGILVGNFFDRGLVSYYSNPHWLYHAEKQRIVQKAFFEATFSIMGHVAKSDGRVSEQEISMAKSIMNEMKLSKGQKDLAKRLFNEGKQADFNVSLALIQLQRICKDNRDLLKLFVDIQYRAAQVDGLSSQKIHALDNIFTHLGFAPLHKQYRFYEDFGSYFQQEQSKQHYHNQQEYKHTSSSQGQQGYKPQSPPNTLAHAFALLEVSPNANKQEVRRAYRRLLSRNHPDKLIAQGLPEEMIKLANDKTHQIMKAYELICETKGW

djlA

Co-chaperone protein DjlA

291 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

33.156 kDa

MRYWGKLLGLALGIVSSTGIWGMIMGLLMGHWIDRARASRRRDYFSAQSTRQSLFFLTTFQAMGHLTKSKGRVTEADINIATKMMDRLELFGDARAAAQRAFREGKAGQFPLRIKLRKLRDACLGRFDLIKMFLEIQLQVAFVDGVLHPNERRVLYVIADELGVTREQFEFFLRNMESPTGQQSRQNQSRQNGKSQQRRNNGYSNGHSYGGQRPPSPLRGPTVESACRTLGVRSSDDAVTIKRAYRKLMSEHHPDKLVAKKLSPRMMEMAKRKAQDIQAAYELLKSANQTK

djlA

Co-chaperone protein DjlA

288 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

32.523 kDa

MEFIGKIIGVFLGWKVGGFFGAIAGLILGSIADKKLYELGSVSSSFFKKKTTRQDLFMQTSFAVLGHLSKSKGRVTEEDIQLANQLMIQLKLDDAGRKLAQDAFRRGKESDFPIRQVIREFRIGCGQRADLLRMFLQVQVQAAFADSELHENEKEVLYVIAEELGLSRMQFEQMIAMEMAARAFTQGGFYQKYQQGAYQGGYQYQQQNSGGYQHASGPTLNDAYKVLGVTESDEQSTVKRAYRRLMNEHHPDKLVAKGLPPEMMEMAKEKTQQIQAAYDLICKAKGWK

djlA

Co-chaperone protein DjlA

288 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

32.878 kDa

MNFIGKILGFIIGYRFGGLFGGIAGLILGHIADKKLYELGSVNSSFFSKKITRQSLFMQTTFAVLGHLSKAKGRVTEEDIQLANNLMSQMQLDVANRQLAQNAFNRGKEADFPVREVIREFRIGCGQRADLLRMFLHIQVQAAFADSNLHNNEKELLFVIAEELGLSRFQFDQMLAMEMAARQFTQGGFYRQQQYQQQSHQQYNQENYQNSYRTSSGPTVEDAYKVLGVNAGDNQQTVKRAYRRLMNEHHPDKLVAKGLPKEMMEMAKEKAQQIQAAYDLICKVKGWK

djlA

Co-chaperone protein DjlA

287 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

32.76 kDa

MNFIGKFLGLIIGWKLGGFFGAICGVILGHLGDKKLYELGTVNSSFFKSKITRQSLFMQTTFAVLGHLSKAKGRVTEDDIQLASHLMQQMQLDDANRRLAQEAFTRGKAADFPLRQVIREFRLGCGQRADLLRMFLHVQVQAAFADAQLDQSEKDVLYIVGEELGLSRFQFEQMLAMEFAARQFSRAGYQQQNRYQRDYGYQQHQQQYGGYQQQSGPTVDDAYKVLGVSATDDQQTVKRAYRRLMNENHPDKLVAKGLPKEMLEMAKEKTQQIQSAYDLICKTKGWK

djlA

Co-chaperone protein DjlA

287 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

32.229 kDa

MQIFGKILGAFFGFLFGGVFGALFGLFIGHQFDKARRLSQAGFKTAGFGQGPSQAQRQEEFFKSAFAVMGHVAKAKGQVTKEEIQLASAMMDRMSLHGEQRRAAQDAFREGKERDFPLEQVLERVKIATSGRFDLLQFFLELQISAAFADGDVHPSERNVLHKIARGLGFSSEQLERRLQMQEAAFRFQRQGGFGGQQHQSHHSSSHGGWQQASQTDRLADAYKILGIDANADGKEVKRAYRKLMNEHHPDKLMAKGLPPEMMNMAKEKSQEIQSAYDLIKKEKGFK

djlA

Co-chaperone protein DjlA

287 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

32.243 kDa

MQIFGKILGAFFGFLFGGVFGALFGLFIGHQFDKARRLSQAGFKTAGFGQGPSQAQRQEEFFKSAFAVMGHVAKAKGQVTKEEIQLASAMMDRMSLHGEQRRAAQDAFREGKERDFPLEQLLERVKIATSGRFDLLQFFLELQISAAFADGDVHPSERNVLHKIARGLGFSSEQLERRLQMQEAAFRFQRQGGFGGQQHQSHHSSSHGGWQQASQTDRLADAYKILGIDANADGKEVKRAYRKLMNEHHPDKLMAKGLPPEMMNMAKEKSQEIQSAYDLIKKEKGFK

djlA

Co-chaperone protein DjlA

286 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

32.503 kDa

MQFIGKIIGFFIGYKLFGGLFGGLLGIFIGHLADKKLYELGSVRSSIFGKNLTRQSLFMQTTFAVLGHIAKAKGRVTEDDIQLARQLMVRLRLDNANQQLAQQAFTLGKEANFPLRQVIQEFREACGQRADLLRFFVEVQMQAAAQDGQLDINEQQILFTIAETIGMSRFQFEQMLAMVMAAQQFRSGGFYQQYSQQQGSYQQHSYDGYQYSNNGPNIKDAYTVLGINENDEHNAVKRAYRKLMNEHHPDKLAAKGLPDEMMELAKEKAQQIQAAYDLICKTKGWK

djlA

Co-chaperone protein DjlA

284 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

31.895 kDa

MHIFGKILGAFFGFLFGGPFGAIFGIFLGHQFDKARRLNQAGFQSGTFGAGPSQAERQEEFFKSAFSVMGHVAKAKGQVTKEEIQLATIMMDRMNLTLEQKRAAQDAFRDGKESDFPLEQVLERVKIATGGRFDLLQFFLELQVSSAFADGDVHPSERQVLHRIARGLGFSSEQLERRLRMQEAAFRFQQGGGFGGSQQQSHSGQQWQQPSSRHQLADAYEVLGVSESASAQEVKRAYRKLMNEHHPDKLMAKGLPPEMMNVAKEKSQQIQHAYELIRKEKGIK

djlA

Co-chaperone protein DjlA

284 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

31.731 kDa

MHIFGKILGAFFGLLLGGPFGLLFGLFIGHQFDKARRLSQAGFSTGGFGKGPSQAQRQEEFFKAAFAVMGHVAKAKGQVTKEEIQLATAMMDRMNLHGEQRRAAQDAFREGKESDFPLEDVLVRVKISTAGRFDLLQFFLELQISAAFADGAIHPSERNVLHKIARGLGFSSEQLERRLQMQEAAFRFQHQGGFHGQQQGQYQSSGWQQASQADQLADAYKILDVSPEADGKTVKRAYRKLMNEHHPDKLMAKGLPPEMMNVAKEKSQEIQNAYDLIKKVKGFK

djlA

Co-chaperone protein DjlA

283 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

31.601 kDa

MQIFGKILGGFFGFLFGGFFGAALGIFIGHQFDKAKRMANSGFTFQTGGASQTQRQAEFFHAAYAVMGHVAKAKGQVTREEIQLASMMMDRMNLSDEQKREAQEAFREGKESDFPLRETLRNIRSITGGRYDLLQFFLELQIAAAIADGDIHPSERDVLHIVAEELGFSAEQLEKRLRMQEAAFRFQQGGGFSGHQSGGSHQQGQWQQASSASQLKDAYNLLGISEDADPKTIKRAHRKLMNEHHPDKLVAKGLPPEMMNMAKEKAQEIQAAYDLIKKEKGIK

djlA

Co-chaperone protein DjlA

277 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

31.123 kDa

MWGKILGAFFGFLLGGPFGLLLGLFLGHKFDKARRNVYRGGGFGGFGTNRANSEERQAEFFYAGFAVMGHMAKAKGHVTEEEIRVASAIMDRMNLHGEARRQAQNAFREGKEDGFPLEETLAKVRQNCAGRADLLQFFLELQIQAAFADGSLHQNERQLLHVIARSLGFSERQLEQRLHMQEAAFRFQQGGFNQQHGGGFNQAPTRDQLADAYEVLGVTESATSQEVKRAYRKQMNEHHPDKLAAKGLPPEMMEIANQKAQELQAAYDMIRKEKGFK

djlA

Co-chaperone protein DjlA

277 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

31.065 kDa

MRYWGKLLGLVLGVMYAPGVVGALLGLLVGHMVDRALGAKRRGFFADQQTRQSLFFRTTFQVMGHLTKAKGRVTEVDIQLASQLMDRMQLHGAARTAAQQAFREGKESHFPLRKALQEFRRVCFGRFDLIRIFLEIQLQAAFADGSLHPNERQVLYVIAEELGISRGQFDQFLRMFDGGRQFGGHGGWQGQQGGYSQSGYQRASQGPTLEDACKVLGVNSSDDSVAIKRAYRKLMGEHHPDKLVAKGLPPEMMEMAKQKAQEIQAAYDLIKREKGFK

djlA

Co-chaperone protein DjlA

277 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

31.105 kDa

MRYWGKLLGLVLGVMYAPGVVGALLGLLVGHMVDRALGAKRRGFFADQQTRQSLFFRTTFQVMGHLTKAKGRVTEVDIQLASQLMDRMQLHGAARTAAQQAFREGKESHFPLRKTLQEFRRVCFGRFDLIRIFLEIQLQAAFADGSLHPNERQVLYVIAEELGISRGQFDQFLRMFDGGRQFGGHGGWQGQQGGYSQSGYQRAPQGPTLEDACKVLGVNSSDDSVAIKRAYRKLMGEHHPDKLVAKGLPPEMMEMAKQKAQEIQAAYDLIKREKGFK

djlA

Co-chaperone protein DjlA

273 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

30.898 kDa

MHYWGKLLGLIFGVVSGAGFWGIVIGLFIGHMLDRASVRGNQGFFANNQSRQLLFFSSTFQVMGHITKSKGRVTETDIRLASQLMERMQLHGQARIAAQQAFREGKEPNFPLRETLRQLRRACFGRSDLIRMFLEIQLQAAFSDGQLHPNERTVLFIIADELGISRNQFEQFLAMMEGGRNFGDGGEWQQRQYGGYQKAAQGPTLADACKVLGVREKDDATTIKRAYRRLMSEHHPDKLVAKGLPPEMMEIAKQKAQSIQAAYDLIKKEKGFK

djlA

Co-chaperone protein DjlA

271 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

30.565 kDa

MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFDKARSRKMAWFANQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVGKSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGISRAQFDQFLRMMQGGAQFGGGYQQQSGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK

djlA

Co-chaperone protein DjlA

271 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

30.565 kDa

MQYWGKIIGVAVALIMGGGFWGVVLGLLIGHMFDKARSRKMAWFANQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVGKSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGISRAQFDQFLRMMQGGAQFGGGYQQQSGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK

djlA

Co-chaperone protein DjlA

271 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

30.579 kDa

MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFDKARSRKMAWFANQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVGKSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGISRAQFDQFLRMMQGGAQFGGGYQQQTGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK

djlA

Co-chaperone protein DjlA

271 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

30.565 kDa

MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFDKARSRKMAWFANQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVGKSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGISRAQFDQFLRMMQGGAQFGGGYQQQSGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK

djlA

Co-chaperone protein DjlA

270 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

31.291 kDa

MNWIGKLIGMMLGFILAGPIGLIIGLFIGHVVFDQGRFRQWFQTTASARSQPSKIQEVFFNTTFRVMGFVAKADGRVSENEIRQARQVMQQMNLDDSMKREAIRLFTEGKQPNFNLDESLNELRQACVFQPALLRVFLEIQIQMASADGQGLSGQKRQVLQTICRRLEVFGFDYNQFEQRFRAEQNYQRYQQRATQDPRAYLNDAYKVLGLTSAATDSEIKKSYRRLMSQHHPDKLMAKGLPPEMMKMATQKTQQIKKAYEQIRKVRSMV

djlA

Co-chaperone protein DjlA

270 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

30.583 kDa

MQYWGKIIGVAVALMMGGGFWGVVLGLLVGHMFDKARSRKMAWFANQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGDSRTAAQNAFRVGKADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNEREVLYVIAEELGISRVQFDQFLRMMQGGAQFGGGYHQQSGGGWQQAQRGPTLEDACNVLGVKTTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK

djlA

Co-chaperone protein DjlA

270 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

30.583 kDa

MQYWGKIIGVAVALMMGGGFWGVVLGLLVGHMFDKARSRKMAWFANQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGDSRTAAQNAFRVGKADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNEREVLYVIAEELGISRVQFDQFLRMMQGGAQFGGGYHQQSGGGWQQAQRGPTLEDACNVLGVKTTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK

djlA

Co-chaperone protein DjlA

270 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

30.583 kDa

MQYWGKIIGVAVALMMGGGFWGVVLGLLVGHMFDKARSRKMAWFANQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGDSRTAAQNAFRVGKADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNEREVLYVIAEELGISRVQFDQFLRMMQGGAQFGGGYHQQSGGGWQQAQRGPTLEDACNVLGVKTTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK

djlA

Co-chaperone protein DjlA

262 amino acids

Regulatory DnaK co-chaperone. Direct interaction between DnaK and DjlA is needed for the induction of the wcaABCDE operon, involved in the synthesis of a colanic acid polysaccharide capsule, possibly through activation of the RcsB/RcsC phosphotransfer signaling pathway. The colanic acid capsule may help the bacterium survive conditions outside the host.

29.644 kDa

MRFWGKFFGFVIGFMFGRFFGALLGLWLGHLYDKRPGGGASFSQILGQAKNRQGIFFNTTFAVMGHVAKASGRVTETDIRIATLLMDQMRLTGDARKEAQQAFREGKEPDFDLCSSLQAFRAVTQGRQELVQMFIEIQIQTALSDGELDAAEHAILMTVAQELGYGRQQLDELLKRWQAEFRFHQTSSGNKTSITDAYHLLGITAEATDQEVKRAYRKLMNEHHPDKLVAKGLPPEMMEIANRKAQDIQAAYDRVKSERGMR