def2

Peptide deformylase 2

209 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

23.979 kDa

MKIVTTDSENKAVLYKVASEVEIPLTKTTKEKIEAMRIFYKSFQGKAGFAVPQVGLSERIILVEQHLFDTTMAEETDEPTILVNPSWRPISDKKEWDIEGCLSVPGKVGVVERYVHVELTAWLYHSDTEALSKIKREYHREYSSVLWQHEIDHLEGKIYVDKAKLLLNEKDFYSFRQQLIESGKIQSGMALFDLGPLIYDIVVKGEIPS

def2

Peptide deformylase 2

201 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

22.311 kDa

MARSFAQLARTAEKTKGSVAVPKEPLDHPPLQIHTLGNGVLRQSTRRIGKVDESVRDLVRDMLRSMYAAKGIGLAAPQVGIHKQLLVLDLDLETPTTPPVVLINPEIISSSATVETYEEGCLSIPGVYLNVVRPSEIVLSFRDEMGRPRKMKADGLMARCIQHEMDHLEGVLFVDRVTDENELSLELKEHGFKRADVRPLV

def2

Peptide deformylase 2

193 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

21.168 kDa

MTVRPIVIHGDPVLHNPTREVTEPISELQELIADMYETMEVANGVGLAANQIGVSKRIFVFNCPDDEGTMHRGCFINPVLETSEIPETMPADDGSDEEGCLSVPGEGFPTGRADWAKVTGLNEDGEEWSMEGTGFLARCFQHEVGHLDGVVYTDTLIGRWKRLAKKTIKANGWTEPGLTWTPGVDEDPFGHDV

def2

Peptide deformylase 2

193 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

21.139 kDa

MTVRPIVIHGDPVLHNPTQLVTEDVSELQELIADMYETMDVANGVGLAANQIGVSKRIFVYDCPDDEGVMHKGCFINPVLETSEIPETMPADDGSDEEGCLSVPGEGFPTGRAHWAKVTGLNEKGEEVSVEAEGFLARCFQHEVGHLDGFLYTDVLIGRWKRMAKKAIKANGWTEPGLTWMPGEDEDPFGHDA

def2

Peptide deformylase 2

187 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

20.557 kDa

MANQLQVPKQKLAKPPLAIHTLGDRVLRQGSKQISGINDEVRKLAQQMLQTMYSADGIGLAAPQVGVNKRMIVVDIDPENAARPPLVLINPLIKQFSSDLAVDQEGCLSVPSIYADVRRPERVVATYRDLNGRPVTLEATGLLARCIQHEIDHLDGVLFVDRVENQIALAPQLVEKGFAVRDVQVRA

def2

Peptide deformylase 2

185 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

20.573 kDa

MIEPLPRILVSELCKFVMAILNILRYPDERLHKIATEVPSITREIRTLVSNMAETMYAAPGIGLAATQVDVHQRIIVIDVSETRDELLVLINPEIIASSGNAETQEGCLSVPGIFDKVTRAEEVTVRATGIDGKSFEMDASGLLAVCIQHEMDHLMGKVFVEYLSPFKQSRILSKLKKQARRQIA

def2

Peptide deformylase 2

184 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

20.515 kDa

MLTMKDVIREGDPILRNVAEEVVIPASEEDTNTLKEMIEFVINSQDPEMAEKYSLRPGIGLAAPQIGISKKMIAVHVTDTDGTLYSHALFNPKIISHSVERTYLQSGEGCLSVDREVPGYVPRYTRITVKATSINGEEVKLRLKGLPAIVFQHEIDHLNGVMFYDHINKENPFAAPDGSKPLER

def2

Peptide deformylase 2

184 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

20.474 kDa

MLTMKDVIREGDPILRNVAEEVSLPASEEDTTTLKEMIEFVINSQDPEMAEKYSLRPGIGLAAPQIGVSKKMIAVHVTDADGTLYSHALFNPKIISHSVERTYLQGGEGCLSVDREVPGYVPRYTRITVKATSINGEEVKLRLKGLPAIVFQHEIDHLNGVMFYDHINKENPFAAPDDSKPLER

def2

Peptide deformylase 2

179 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

20.136 kDa

MNPELLPIIQLGNPTLRQKAAWVENIHDATIQQLIDDLIATVAKANGVGIASPQVAQSYRLFIVASRPNPRYPHAPEMEPTAMINPKIVGHSTEIVEGWEGCLSVPGIRGLVPRHQAIEVEYTDRYGNLQKQTLTDFVARIFQHEFDHLDGVLFIDRVESNLNTITEEEYQELVTKNTK

def2

Peptide deformylase 2

179 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

20.051 kDa

MIRNILKMGDERLLRIAPPVPAEMFGSSELETLIADMFETMHSVGGVGLAAPQIGIDLQLVIFGFERSERYPQAEAVPQTILLNPLITPLHPGVEEGWEGCLSVPGLRGMVDRYQSIRYEGFDPDGQPIERIAHGFHARVVQHECDHLIGRLYPSRITDFSKFGFMDVMFPDMDPNADE

def2

Peptide deformylase 2

178 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

19.852 kDa

MIRDILKMGDERLLRIAPPVPEHMLGSAELQQLIDDMFETMRHVGGVGLAAPQVGIDLQLVIFGFERSERYPDAEAVPQTILLNPVITPTSSEVEDGWEGCLSVPGLRGVVPRFKHICYQGIDPQGSPINRFADGFHARVVQHECDHLIGRLYPSRIQDFAKFGYTEVLFPGLEVSED

def2

Peptide deformylase 2

176 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

19.881 kDa

MIHAILKMGDPRLLRVAAPVERYDTPELRALIDDMFETMAHAQGVGLAAPQIGVDLQLVIFGFERNDRYPDAPAVPRTILCNPVIEPLSGEMEDGWEGCLSVPGLRGLVPRYRHIRYSGYDPAGQRIEREAEGFHARVVQHECDHLIGRLYPTRIRDLTKFGYTEVLFPEMDPNAD

def2

Peptide deformylase 2

176 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

19.939 kDa

MIHAILKMGDPRLLRVAAPVERYDTPELRALIDDMFETMAHAQGVGLAAPQIGVDLQLVIFGFERNDRYPDAPAVPRTILCNPVIEPLSDEMEDGWEGCLSVPGLRGLVPRYRHIRYSGYDPAGQRIEREAEGFHARVVQHECDHLIGRLYPTRIRDLTKFGYTEVLFPEMDPNAD

def2

Peptide deformylase 2

170 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

19.329 kDa

MALLSILRYPDPRLHKTAKPVAVVDDRIRQLVRDMADTMYDAPGVGLAATQVDVHERVVVIDVSEEGNDLRVLINPEITWKSDERQTYEEGCLSVPGIYDEVERAARIRCKALDQQGQPYEFEADGLLAVCVQHEIDHLDGKVFVEYLSNLKQNRIKTKLKKAEREAERA

def2

Peptide deformylase 2

170 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

19.047 kDa

MALLPILEFPDPRLRTKAVPVDAAEVVSPAFQTLLDDMFQTMYEAPGIGLAASQVDVHKRFMVIDVSEEKDAPQVFINPEIVTRQGEQVYQEGCLSVPGIFADVSRADAITVRYLDRQGQPQELSTDGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLAKLRKHVA

def2

Peptide deformylase 2

162 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

18.369 kDa

MAIREIRVVPDPVLRTPCDEIKEITPAVRRLVDDLLETVDDPGRAGLSANQIGVSLRAFSYNIDGKVGYVLNPVLEEKSGEQYGDEGCLSVPGLWYKTRRADYARVRGIDLDGNEVVLEGSGLMGRMLQHECDHLDGHVYLDRLEKEERREALRYMRNRQAK

def2

Peptide deformylase 2

155 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

17.505 kDa

MAVKKIVQIGHEALKKVSEPVKDVNEVKGLIQDLKDTLATVEGIGLAAPQIAVNKRVVYINFGDGENEYVLINPEVTGVSKETYEDYEGCLSYVMHEGLVERPRAVRIQALNEKGELKVYEAQDLLARCFLHEIDHLEGIMYVDRAKEMYELVEK

def2

Peptide deformylase 2

150 amino acids

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Belongs to the polypeptide deformylase family.

16.737 kDa

MALRQIRLSEDEILRKKSRPVEVVDDKIRQILDDMLDTLQNTENGAAIAAPQVGILKQLVVIATGEDIIKLVNPKIVKKEGEQEVVEGCLSIPNVYGKLKRPKKVTVEALNENGEKITLTGEGFLAKCFCHEIDHLDGILFTDLVTEYIK

Def2

Defensin-2

83 amino acids

Plant defense peptide. Has antifungal activity.

Belongs to the DEFL family.

8.963 kDa

MAGKGVGTPLSALFLLVLLVVTIGMMEVQVAEGRMCKTPSAKFKGYCVSSTNCKNVCRTEGFPTGSCDFHITSRKCYCYKPCP