decr2

Peroxisomal 2,4-dienoyl-CoA reductase

300 amino acids

Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA (By similarity).

Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.

31.999 kDa

MAEKPQLVNNLPEDVETDECMNKYTHIYSPDLLSDQVAFITGGGSGIGFRIAEVLMRHGCDTVIASRNLEKISQAAKKLTSTTGRRCLPIAMDVRQPETILAAVDETLKTFGRVDILINNAAGNFLCPATSLSFNAFKTVMEIDTMGTFNTSKVIYDKWFKDHGGSIVNISATLGYRGQALQVHAGSAKAANDAMTRHLAVEWGPSGVRVNTVAPGPISGTEGYRRLGGSHAETAGAFHSIPLQRAGNKTEMAHAVLFLASRASSYVTGSVLVADGGAWLTSANDVERLLGIVSSRSAKL

DECR2

Peroxisomal 2,4-dienoyl-CoA reductase

292 amino acids

Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.

Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.

30.778 kDa

MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL

Decr2

Peroxisomal 2,4-dienoyl-CoA reductase

292 amino acids

Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.

Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.

31.3 kDa

MAQPPPDVEGDDCLPEYHHLFCPDLLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVGRSLQKVTTAAKKLVAATGKRCLPLSMDVRVPPEVMTAVDQALQEFGKINILINCAAGNFLCPASALSFNAFKTVVDIDTIGTFNVSSVLYKKFFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLRGSNASSKLKHFSNPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTFPNGIKQLLEFESFSAKL

DECR2

Peroxisomal 2,4-dienoyl-CoA reductase

292 amino acids

Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.

Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.

30.792 kDa

MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAIVAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNDVKGLADFASFSAKL

Decr2

Peroxisomal 2,4-dienoyl-CoA reductase

292 amino acids

Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.

Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.

31.292 kDa

MTQQPPDVEEDDCLSEYHHLFCPDLLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVSRSLPRVSEAAKKLVAATGKRCLPLSMDVRVPPAVMAAVDQALKEFGKIDILINCAAGNFLCPASALSFNAFKTVVDIDTLGTFNVSRVLYEKFFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLGGPKASSKFKYLSSPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTLPNDIGRLLEFESSSAKL