ddrB

Single-stranded DNA-binding protein DdrB

188 amino acids

ssDNA-binding protein that contributes to the ionizing radiation resistance of D.radiodurans. Plays a role in DNA repair and genome reconstitution in a RecA-independent process. Required for recovery from severe genomic fragmentation as a result of exposure to severe levels of ionizing radiation. Binds ssDNA but not dsDNA. Stimulates annealing of complementary ssDNA. Does not complement an ssb disruption.

20.83 kDa

MLQIEFITDLGARVTVNVEHESRLLDVQRHYGRLGWTSGEIPSGGYQFPIENEADFDWSLIGARKWKSPEGEELVIHRGHAYRRRELEAVDSRKLKLPAAIKYSRGAKVSDPQHVREKADGDIEYVSLAIFRGGKRQERYAVPGGAAGNGQGRPAPQGQPAQARPQATAARPAARPPVQPGQEEETPF

ddrB

Single-stranded DNA-binding protein DdrB

178 amino acids

ssDNA-binding protein that probably contributes to the ionizing radiation resistance of D.geothermalis. Plays a role in DNA repair and genome reconstitution, in a RecA-independent process, and is necessary for recovery from severe genomic fragmentation as a result of exposure to severe levels of ionizing radiation (Probable). Binds single-stranded DNA but not duplex DNA.

19.866 kDa

MLHIEFITDLGAKVTVDVESADKLLDVQRQYGRLGWTSGEVPVGGYQFPLENEPDFDWSLIGARKWTNPEGEEMILHRGHAYRRRELEAVDSRKMKLPAAVKYSRGAKNTDPEHVREKADGEFEYVTLAIFRGGKRQERYAVPGSNRPQAGAPARSAATRAQGARPGAVAVQDEETPF