ddi2

Protein DDI1 homolog 2

411 amino acids

Aspartic protease that mediates the cleavage of NFE2L1/NRF1 at 'Leu-104', thereby promoting release of NFE2L1/NRF1 from the endoplasmic reticulum membrane. Ubiquitination of NFE2L1/NRF1 is a prerequisite for cleavage, suggesting that DDI2 specifically recognizes and binds ubiquitinated NFE2L1/NRF1. Seems to act as a proteasomal shuttle which links the proteasome and replication fork proteins like RTF2. Required for cellular survival following replication stress.

Belongs to the DDI1 family.

45.596 kDa

MLLTVFCAPRDRSETTFALDVSPELELRDFLALCELESGIPAGEIQIIYAEQPLQDPTRALGNYGLKDGDVLVLRQAERLRAPPQPTVPGLPRIDFSSIAVPGTSSGQNRNRPQQAQRPSTTQPPPPQATTSPGSGVSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLERFTKVLMEQQQDRARRDQERIKLLTADPFDLDAQAKIEEEIRQHNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEDQPMDMLLGLDMLKRHQCSIDLKKNVLLIGTTGTETRFLPEAELPECARLAYGPEGREEPRPDEIADRELAEAIQRSVQDSGKMHDM

DDI2

Protein DDI1 homolog 2

399 amino acids

Aspartic protease that mediates the cleavage of NFE2L1/NRF1 at 'Leu-104', thereby promoting release of NFE2L1/NRF1 from the endoplasmic reticulum membrane (PubMed:27676298, PubMed:27528193). Ubiquitination of NFE2L1/NRF1 is a prerequisite for cleavage, suggesting that DDI2 specifically recognizes and binds ubiquitinated NFE2L1/NRF1 (PubMed:27528193). Seems to act as a proteasomal shuttle which links the proteasome and replication fork proteins like RTF2 (Probable). Required, with DDI1, for cellular survival following replication stress. Together or redudantly with DDI1, removes RTF2 from stalled forks to allow cell cycle progression after replication stress and maintains genome integrity (PubMed:29290612).

Belongs to the DDI1 family.

44.523 kDa

MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQKENADPRPPVQFPNLPRIDFSSIAVPGTSSPRQRQPPGTQQSHSSPGEITSSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQTTFLPEGELPECARLAYGAGREDVRPEEIADQELAEALQKSAEDAERQKP

Ddi2

Protein DDI1 homolog 2

399 amino acids

Aspartic protease that mediates the cleavage of NFE2L1/NRF1 at 'Leu-104', thereby promoting release of NFE2L1/NRF1 from the endoplasmic reticulum membrane. Ubiquitination of NFE2L1/NRF1 is a prerequisite for cleavage, suggesting that DDI2 specifically recognizes and binds ubiquitinated NFE2L1/NRF1. Seems to act as a proteasomal shuttle which links the proteasome and replication fork proteins like RTF2. Required, with DDI1, for cellular survival following replication stress. Together or redudantly with DDI1, removes RTF2 from stalled forks to allow cell cycle progression after replication stress and maintains genome integrity.

Belongs to the DDI1 family.

44.591 kDa

MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQKENADPRPAVQFSNLPRIDFSSIAVPGTSNPQQRQLPRTQAQHSSPGEMASSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVAMLYINCRVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLACSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQTTFLPEGELPECARLAYGTGREDIRPEEIADQELAEAIQKSAEDAERQKP

ddi2

Protein DDI1 homolog 2

394 amino acids

Aspartic protease that mediates the cleavage of NFE2L1/NRF1 at 'Leu-104', thereby promoting release of NFE2L1/NRF1 from the endoplasmic reticulum membrane. Ubiquitination of NFE2L1/NRF1 is a prerequisite for cleavage, suggesting that DDI2 specifically recognizes and binds ubiquitinated NFE2L1/NRF1. Seems to act as a proteasomal shuttle which links the proteasome and replication fork proteins like RTF2. Required for cellular survival following replication stress.

Belongs to the DDI1 family.

43.898 kDa

MLITVYCVRRDLSEVTFSLEVDGDFELENFRALCELESGIPASETLIVYAERPLTNNQRSLASYGLKDGDVVILRQRETPEARPAAPFPGLDFSTIAVPGSSSQPAPSQPQAPPPPPPDTSSFPQGLDNPALLREMLLANPHELSLLKERNPPLAEALLSGDLEKFTKVLLEQQQERARREQERIRLYSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVVMLYINCKVNGYPVKAFVDSGAQMTIMSQACAERCHIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLEKNVLVIGTTGTRTSFLPEGELPECARLAYGPGREEVRPEEIADRELAEVLQKSAEEADQQKP

ddi2

Protein DDI1 homolog 2

393 amino acids

Aspartic protease that mediates the cleavage of NFE2L1/NRF1 at 'Leu-104', thereby promoting release of NFE2L1/NRF1 from the endoplasmic reticulum membrane. Ubiquitination of NFE2L1/NRF1 is a prerequisite for cleavage, suggesting that DDI2 specifically recognizes and binds ubiquitinated NFE2L1/NRF1. Seems to act as a proteasomal shuttle which links the proteasome and replication fork proteins like RTF2. Required for cellular survival following replication stress.

Belongs to the DDI1 family.

43.733 kDa

MLITVYCVRRDLSEITFSLEVDGDFELENFRALCELESGIPASDTLIVYAERPLTDNQRSLASYGLKDGDVVILRQKEAPETRPAAPFPGLDFSTIAVPGASSQPDPSQPQAPPPPPDTSSFPQGLDNPALLRQMLLANPHELSLLKERNPPLAEALLSGDLEKFTKVLQEQQQERARREQERIRLYSADPFDLDAQAKIEEDIRQHNIEENMTIAMEEAPESFGQVVMLYINCKVNGYPVKAFVDSGAQMTIMSQACAERCHIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLEKNVLVIGTTGTHTTFLPEGELPECARLAYGPGREEVPPEEIADRELAEVLQKSADEADQQKP

DDI2

Cyanamide hydratase DDI2

225 amino acids

Cyanamide hydratase involved in the detoxification and/or utilization of cyanamide, a toxic nitrile compound distributed widely in the environment.

Belongs to the cyanamide dehydrase family.

25.152 kDa

MSQYGFVRVPREVEKAIPVVNAPRPRAVVPPPNSETARLVREYAAKELTAPVLNHSLRVFQYSVAIIRDQFPAWDLDQEVLYVTCLLHDIATTDKNMRATKMSFEYYGGILSRELVFNATGGNQDYADAVTEAIIRHQDLTGTGYITTLGLILQIATTLDNVGSNTDLIHIDTVSAINEQFPRLHWLSCFATVVDTENSRKPWGHTSSLGDDFSKKVICNTFGYN