dcn-1

Defective in cullin neddylation protein 1

367 amino acids

Required for neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity. Does not act by preventing deneddylation, but rather facilitates neddylation, possibly by acting with rbx-1 to recruit the Nedd8-charged E2 enzyme to the cullin component of SCF-type complexes (By similarity).

42.028 kDa

MNRLKADQKTKVGKRKQDPPETLSEAEYDVKKCRAQNNANLVGVSNMTSSQTVMPITHLSYASSSSQGLAQSSILSKNCPKNYENILRQFVQWTQATEPVSLNFLAKANWNIEYAMTLYYDNPNLFSSSAPATVDQSKTIQLFTQYVDKRDGLGERIGPHGMQRLLIDLGYEPIDRRVLILAWVFKAETQCEFSLQEFTNGMASLQVDSIQGLKQKIDALDAGMKADLTKTRDLCIFTFNYGKSAASRSLDLEMAICYWDVIFGARKPLMSQWIDFLYGQERMAYARLEEELGPTNAKKVKSVWITRDTWNLFWDFIVLGKEDLSDYDEEGAWPVLIDQFVDHCRENLNYPKPLRENSNAMEHQSYY

dcn-1

Defective in cullin neddylation protein 1

367 amino acids

Required for neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity. Does not act by preventing deneddylation, but rather facilitates neddylation, possibly by acting with rbx-1 to recruit the Nedd8-charged E2 enzyme to the cullin component of SCF-type complexes (By similarity).

42.028 kDa

MNRLKADQKTKVGKRKQDPPETLSEAEYDVKKCRAQNNANLVGVSNMTSSQTVMPITHLSYASSSSQGLAQSSILSKNCPKNYENILRQFVQWTQATEPVSLNFLAKANWNIEYAMTLYYDNPNLFSSSAPATVDQSKTIQLFTQYVDKRDGLGERIGPHGMQRLLIDLGYEPIDRRVLILAWVFKAETQCEFSLQEFTNGMASLQVDSIQGLKQKIDALDAGMKADLTKTRDLCIFTFNYGKSAASRSLDLEMAICYWDVIFGARKPLMSQWIDFLYGQERMAYARLEEELGPTNAKKVKSVWITRDTWNLFWDFIVLGKEDLSDYDEEGAWPVLIDQFVDHCRENLNYPKPLRENSNAMEHQSYY

dcn-1

Defective in cullin neddylation protein 1

295 amino acids

Required for neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity. Does not act by preventing deneddylation, but rather facilitates neddylation, possibly by acting with rbx-1 to recruit the Nedd8-charged E2 enzyme to the cullin component of SCF-type complexes.

34.133 kDa

MNRLKSDQKTKLRQFVQWTQVTEAVSLNFLAKANWNIEYAMTLYFDNPNLFAGSTPQPSVDRSNIERLFNQYVDPKDKVGEKRMGPHGINRLLTDLGYEATDRRVLVLAWKFTAQTQCEFSLDEWVKGMTALQADTVQNLRQRIDSINSGLESDKAKFHELYLFAFNYAKSAACRNLDLETAICCWDVLFGQRSTIMTQWIDFLWAQENAAASRLAQNVGASNAKQFKSVWISRDTWNLFWDFILLSKPDLSDYDDEGAWPVLIDQFVDYCRENLNYPKPGNASNDQQMETPSYY

dcn-1

Defective in cullin neddylation protein 1

295 amino acids

Required for neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity. Does not act by preventing deneddylation, but rather facilitates neddylation, possibly by acting with rbx-1 to recruit the Nedd8-charged E2 enzyme to the cullin component of SCF-type complexes.

34.133 kDa

MNRLKSDQKTKLRQFVQWTQVTEAVSLNFLAKANWNIEYAMTLYFDNPNLFAGSTPQPSVDRSNIERLFNQYVDPKDKVGEKRMGPHGINRLLTDLGYEATDRRVLVLAWKFTAQTQCEFSLDEWVKGMTALQADTVQNLRQRIDSINSGLESDKAKFHELYLFAFNYAKSAACRNLDLETAICCWDVLFGQRSTIMTQWIDFLWAQENAAASRLAQNVGASNAKQFKSVWISRDTWNLFWDFILLSKPDLSDYDDEGAWPVLIDQFVDYCRENLNYPKPGNASNDQQMETPSYY