DCC1

Sister chromatid cohesion protein DCC1

380 amino acids

Component of the RFC-like complex CTF18-RFC which is required for efficient establishment of chromosome cohesion during S-phase and may load or unload POL30/PCNA. During a clamp loading circle, the RFC:clamp complex binds to DNA and the recognition of the double-stranded/single-stranded junction stimulates ATP hydrolysis by RFC. The complex presumably provides bipartite ATP sites in which one subunit supplies a catalytic site for hydrolysis of ATP bound to the neighboring subunit. Dissociation of RFC from the clamp leaves the clamp encircling DNA.

Belongs to the DCC1 family.

44.074 kDa

MSINLHSAPEYDPSYKLIQLTPELLDIIQDPVQNHQLRFKSLDKDKSEVVLCSHDKTWVLKQRKHSNTVLLMREFVPEQPITFDETLLFGLSKPYMDVVGFAKTESEFETRETHGELNLNSVPIYNGELDFSDKIMKRSSTKVIGTLEELLENSPCSALEGISKWHKIGGSVKDGVLCILSQDFLFKALHVLLMSAMAESLDLQHLNVEDTHHAVGKDIEDEFNPYTREIIETVLNKFAVQEQEAENNTWRLRIPFIAQWYGIQALRKYVSGISMPIDEFLIKWKSLFPPFFPCDIDIDMLRGYHFKPTDKTVQYIAKSTLPMDPKERFKVLFRLQSQWDLEDIKPLIEELNSRGMKIDSFIMKYARRKRLGKKTVVTSR

dcc1

Sister chromatid cohesion protein dcc1

357 amino acids

Essential for the fidelity of chromosome transmission. Required for the DNA replication block checkpoint. Replication factor C (RFC) complex has an essential but redundant activity in sister chromatid cohesion establishment. An RFC-like complex (ctf18-RFC) is formed where ctf18 replaces rfc1 in the RFC complex along with the association of dcc1 and ctf8. This complex is required for efficient establishment of chromosome cohesion during S-phase. Acts as a PCNA loader, loading PCNA onto primed templates.

Belongs to the DCC1 family.

41.954 kDa

MEANEERCILLKYPHPSSDISSEYLLLELDDDLLKTLEENPEEEIVFKSDFDKKASVLCTSDKTYAVRQVVQSNSYLLFDELSPTDWVLNDTCYSFLEVERIYGFIFSDDKISYWDEDSVELKPISLTKDQFIRSVPASRNEVDSFLQKNFFMVKNEFLYRLSPSYICSIIDWIFVIAQQLHIDFASFEFKILKKPAMDDEFDWDSVICVLESISSPIKDNVLPKKFNIDLELTTFWYGRFLLEGINSISSDEFIQLWDNRLPYPCKGLPSLNLLKGYYFHDTPNTIQYLSGDQLPREPSRRFQSLFQLKSKWLYEELWSFVKDLALSKSRVEALILKYGRKQTSRDGVYINSRGTW