cyoD

Cytochrome bo(3) ubiquinol oxidase subunit 4

111 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase bacterial subunit 4 family.

12.07 kDa

MSSAAHDNHGAGHGSLGSYAIGFVLSVILTAIPFYMVMDGGFSRHATILTMVVLGLVQVVVHLICFLHMNMSSEGRWNVMAFIFTVIVILLVVGLSLWIIFSADMLMMPMP

cyoD

Cytochrome bo(3) ubiquinol oxidase subunit 4

110 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase bacterial subunit 4 family.

12.376 kDa

MANAHDTHHEGNHGSVKSYMIGFILSIILTAIPFGLAMSPSLPKNLTVLIIVAMAVIQVVVHLVYFLHMDRSKEQRNNVWTFLFTTLVIALLVGLSLWIMFSIHFEMLAK

cyoD

Cytochrome bo(3) ubiquinol oxidase subunit 4

109 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase bacterial subunit 4 family.

12.029 kDa

MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAVILGTILAMAVVQVLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMMMH

cyoD

Cytochrome bo(3) ubiquinol oxidase subunit 4

109 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron.

Belongs to the cytochrome c oxidase bacterial subunit 4 family.

12.029 kDa

MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAVILGTILAMAVVQVLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMMMH

cyoD

Cytochrome bo(3) ubiquinol oxidase subunit 4

109 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase bacterial subunit 4 family.

12.029 kDa

MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAVILGTILAMAVVQVLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMMMH

cyoD

Cytochrome bo(3) ubiquinol oxidase subunit 4

108 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase bacterial subunit 4 family.

12.995 kDa

MNKYKKIKNNFDKEKKSYIVGFLFSLFLTIIPFFCTLNHLFSRKINFFVILLCALSQIIIHFIYFLHLDFSKKNSWNIISLLFILIIVFIIVFGSIWIMYNLNHHVIL

cyoD

Cytochrome bo(3) ubiquinol oxidase subunit 4

105 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase bacterial subunit 4 family.

12.459 kDa

MSSFLNFNMNKEMKSYLLGFLFSSLLTTLPFLLAIEKFFCSEVNYIIFLLCAISQIIIHFVYFLHLSFDPEERWNLITLLFVIIIIFIVVFGSIWIMFNLNHNTM

cyoD

Cytochrome bo(3) ubiquinol oxidase subunit 4

100 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase bacterial subunit 4 family.

11.923 kDa

MLKNRYLKYLFILILLSILSIMPIFAIIYRIFSRNYLYAFIIVCLFFQILAHIKFFLNLDFSLEQRWKLISVIFSLVVGLIILLGSIWVIKNLNNNLCIM