ctc-1

FACT complex subunit ctc-1

565 amino acids

Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II (By similarity).

Belongs to the SSRP1 family.

62.909 kDa

MAAIESFDNIYLDLSKESGKSRFAENGLGWKPAGGGEAFTLDSSNIGGAQWSRAARGYEVKILLRSSGVVQLDGFHQEDYERLSKIFKNWYSVNLENKEHSLRGWNWGKAEFSKAELTFNVQNRPAFEIPYSEISNTNLAGRNEIAVEFAGNDGGKSNGHSGTGGKGKKASAGKDQLVEVRFYIPGTTTRKEAEGGEAGSDADEEEKNAVTLFYDTLIEKAEIGETAGDTIATFLDVLHLTPRGRFDIDMYDASFRLRGKTYDYKIQYDAIKKFMVLPKPDDLHFLLCIGLDPPLRQGQTRYPFVVMQFKADEEVTLDLNITEEELNGKYKDKLQSHYEQPLHQVVAYIFKGLANKKVTTPAKDFTTHRQQYGIKCSIKASEGFLYCLEKAFMFVPKPATYISYEQTQSITFSRVGGAVSALSTFDITVHMKNGAGSSQFSNINREDLKALEEFFKLKGLRVKNEIDDDTNLIAAALGDDDMASSDEEAVGPKADRGSADEDEESVDEDFQAESESDVAEEYDSNHESDGSGSEESDVDNRVDDEDEDMDDDEGEKRPKKKKKTA