cse2

CRISPR-associated protein Cse2

169 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA) (By similarity).

Belongs to the CRISPR-associated CasB/Cse2 family.

19.405 kDa

MSPGERFLDWLKRLQGQKAWTAARAAFRRSLAFPPGAYPRAMPYVEPFLAKGDWRQEEREAHYLVAALYALKDGDHQVGRTLARALWEKAQGSASVEKRFLALLEADRDQIAFRLRQAVALVEGGIDFARLLDDLLRWFSPERHVQARWAREYYGAGASEEEKKKEVEA

CSE2

Mediator of RNA polymerase II transcription subunit 9

152 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 9 family.

17.522 kDa

MTAPRLISKYRIQIHRISENMVLNNDGLKEISTLLVSASDREPEVKLEKTKDNSSSDITTPPAEFIPSIFFSLHKIRKDPNNVSSQLETSTGFIRHRIKRCKALLQENEEVRNLLANSIEEWENIIADKEQQLRVKAKVLRDLDARIEKITN

CSE2

Mediator of RNA polymerase II transcription subunit 9

149 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. The Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins.

Belongs to the Mediator complex subunit 9 family.

17.376 kDa

MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTSSNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPSEWQDIIHQREQELQIKRDVLDDLYRKLQR

CSE2

Mediator of RNA polymerase II transcription subunit 9

149 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. The Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins.

Belongs to the Mediator complex subunit 9 family.

17.376 kDa

MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTSSNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPSEWQDIIHQREQELQIKRDVLDDLYRKLQR

CSE2

Mediator of RNA polymerase II transcription subunit 9

127 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 9 family.

14.135 kDa

MSAQASPATELQNPTLGQVYATLTRHSAQQTEFIPHIFYALHQLKNDNGHTNTFETATSNIRHRLKLCKAAIAGDAHAVEMLSRPCDEWPAVVCQKEQEIEAKKRVHRQLRQRVEEIAGPLDAAAAP

CSE2

Mediator of RNA polymerase II transcription subunit 9

123 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 9 family.

14.21 kDa

MTGDTEKEQEPSSGEQQLNVLKRIHEILTKHSSTQTEFIPLLYHSLKQISKHPNNSSNSLDAATSSIRHRLKTAKTLLQQDPAAIELVSKTPEQWQLHIQEKKIELEKKTKHLQRLRESIQKQ

CSE2

Mediator of RNA polymerase II transcription subunit 9

123 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 9 family.

14.21 kDa

MTGDTEKEQEPSSGEQQLNVLKRIHEILTKHSSTQTEFIPLLYHSLKQISKHPNNSSNSLDAATSSIRHRLKTAKTLLQQDPAAIELVSKTPEQWQLHIQEKKIELEKKTKHLQRLRESIQKQ