Function
Involved in the biosynthesis of C30 carotenoids. Catalyzes the oxidation of the terminal methyl side groups of 4,4'-diapolycopene to yield 4,4'-diapolycopen-4,4'-dial via the aldehyde intermediate 4,4'-diapolycopen-al. Also able to catalyze the oxidation of the terminal methyl side group of 4,4'-diaponeurosporene to form 4,4'-diaponeurosporen-4-al. It has moderate to low activity on the C40 substrates neurosporene and lycopene, and has no detectable activity on zeta-carotene or beta-carotene.
Sequence
MNSNDNQRVIVIGAGLGGLSAAISLATAGFSVQLIEKNDKVGGKLNIMTKDGFTFDLGPSILTMPHIFEALFTGAGKNMADYVQIQKVEPHWRNFFEDGSVIDLCEDAETQRRELDKLGPGTYAQFQRFLDYSKNLCTETEAGYFAKGLDGFWDLLKFYGPLRSLLSFDVFRSMDQGVRRFISDPKLVEILNYFIKYVGSSPYDAPALMNLLPYIQYHYGLWYVKGGMYGMAQAMEKLAVELGVEIRLDAEVSEIQKQDGRACAVKLANGDVLPADIVVSNMEVIPAMEKLLRSPASELKKMQRFEPSCSGLVLHLGVDRLYPQLAHHNFFYSDHPREHFDAVFKSHRLSDDPTIYLVAPCKTDPAQAPAGCEIIKILPHIPHLDPDKLLTAEDYSALRERVLVKLERMGLTDLRQHIVTEEYWTPLDIQAKYYSNQGSIYGVVADRFKNLGFKAPQRSSELSNLYFVGGSVNPGGGMPMVTLSGQLVRDKIVADLQ