crt-1

Calreticulin

396 amino acids

Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. This lectin may interact transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Probably by controlling the folding of extracellular matrix protein unc-52/Perlecan, may play a role in the formation of fibrous organelles, a hemidesmosome-like structure attaching muscles to the epidermis.

Belongs to the calreticulin family.

45.809 kDa

MKSLCLLAIVAVVSAEVYFKEEFNDASWEKRWVQSKHKDDFGAFKLSAGKFFDVESRDQGIQTSQDAKFYSRAAKFDKEFSNKGKTLVIQYTVKHEQGIDCGGGYVKVMRGDADLADFHGETPYNVMFGPDICGPTRRVHVILNYKGENKLIKKEITCKSDELTHLYTLILNADNTYEVKIDGESAQTGSLEEDWDLLPAKKIKDPDAKKPEDWDEREYIDDAEDVKPEDWEKPEHIPDPDAKKPEDWDDEMDGEWEPPMIDNPEYKGEWKPKQIKNPAYKGKWIHPEIENPEYTPDDELYLYENWGAIGFDLWQVKSGTIFDNVLITDSVEEAEAHAAETFDKLKTVEKEKKEKADEEARKVEEEARKKAEEEKEAKKDDDEEEEKEEEEGHDEL

crt-1

Calreticulin

395 amino acids

Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle (By similarity). This lectin may interact transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER (By similarity). Probably by controlling the folding of extracellular matrix protein unc-52/Perlecan, may play a role in the formation of fibrous organelles, a hemidesmosome-like structure attaching muscles to the epidermis (PubMed:20153198).

Belongs to the calreticulin family.

45.616 kDa

MKSLCLLAIVAVVSAEVYFKEEFNDASWEKRWVQSKHKDDFGAFKLSAGKFFDVESRDQGIQTSQDAKFYSRAAKFDKDFSNKGKTLVIQYTVKHEQGIDCGGGYVKVMRADADLGDFHGETPYNVMFGPDICGPTRRVHVILNYKGENKLIKKEITCKSDELTHLYTLILNSDNTYEVKIDGESAQTGSLEEDWDLLPAKKIKDPDAKKPEDWDEREYIDDAEDAKPEDWEKPEHIPDPDAKKPEDWDDEMDGEWEPPMIDNPEYKGEWKPKQIKNPAYKGKWIHPEIENPEYTPDDELYSYESWGAIGFDLWQVKSGTIFDNIIITDSVEEAEAHAAETFDKLKTVEKEKKEKADEETRKAEEEARKKAEEEKEAKKDDDEEEKEEEEGHDEL

crt-1

Calreticulin

388 amino acids

Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. This lectin may interact transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER (By similarity).

Belongs to the calreticulin family.

45.298 kDa

MQLSLLVGLVCFSAINAKIYFKEDFSDDDWEKRWIKSKHKDDFGKWEISHGKFYGDAVKDKGLKTTQDAKFYSIGAKFDKSFSNKGKSLVIQFSVKHEQDIDCGGGYVKLMASDVNLEDSHGETPYHIMFGPDICGPGTKKVHVIFHYKDRNHMIKKDIRCKDDVFTHLYTLIVNSDNTYEVQIDGEKAESGELEADWDFLPPKKIKDPDAKKPEDWDEREFIDDEDDKKPEDWDKPEHIPDPDAKKPEDWDDEMDGEWEPPMVDNPEYKGEWKPKQKKNPAYKGKWIHPEIEIPDYTPDDNLYVYDDIGAIGFDLWQVKSGTIFDDVIVTDSVEEAKKFGEKTLKITREGEKKKGKKTKKQKKKEKNEKIKKEKMKKRKRANRKKKK