Function
Cysteine protease which plays an essential role in the degradation of proteins in lysosomes (PubMed:15456850, PubMed:24829385). During early embryogenesis, maternally required for the proteolytic processing of yolk proteins in platelets, a lysosome-like structure where a slow and controlled degradation of yolk proteins occurs (PubMed:15456850, PubMed:24829385). In the gonad, required for the clearance of apoptotic germ cells in the engulfing cell phagolysosomes (PubMed:24829385). In embryos, required for the degradation of endocytic and autophagic cargos (PubMed:24829385). In embryos, may play a role in the degradation of lipid-containing droplets (PubMed:26773047). Required for larval development (PubMed:11707440, PubMed:15456850).
Sequence
MNRFILLALVAAVVAVNSAKLSRQIESAIEKWDDYKEDFDKEYSESEEQTYMEAFVKNMIHIENHNRDHRLGRKTFEMGLNHIADLPFSQYRKLNGYRRLFGDSRIKNSSSFLAPFNVQVPDEVDWRDTHLVTDVKNQGMCGSCWAFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESYPYKGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHGDYWIVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV